KEGG   Metarhizium acridum: MAC_08912Help
Entry
MAC_08912         CDS       T03104                                 

Definition
(RefSeq) glutathione S-transferase family protein, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maw  Metarhizium acridum
Pathway
maw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MAC_08912
Enzymes [BR:maw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MAC_08912
Transporters [BR:maw02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAC_08912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 19253223
NCBI-ProteinID: XP_007815252
UniProt: E9EGB4
LinkDB All DBs
Position
Unknown
AA seq 261 aa AA seqDB search
MSEADTKRVKTANEAPYELIYWPNIPGRGEFVRLLFEEAGVSYIDTAKSGGDAVPTVLKL
MDADNKGDEMNPPSFACPALKHGDLRLSQTPNILLYLGPKLGLAPTKGNGIYHINQIALT
ILDGFSNEVHDTHHPVAVSDYYEAQKPEAKRRAKSFIEERLPKFLAYIQRVLDGKASGDG
PWLYGGKLTYADLVLFQGIDGTEFAFPKTMKKMRDSGKYDGVFKLYEVVKERPNIKAYLA
SDRRSQYSDGIWRHYPELEED
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccgacaccaagcgcgtcaagaccgccaatgaagctccctatgagctcatc
tactggcccaacattcccggacgcggcgagtttgtccgccttttatttgaggaagctggg
gtttcatacattgataccgccaaatcgggcggagatgctgtcccgacggttctcaaactc
atggatgctgacaacaaaggtgatgaaatgaaccctccatcttttgcttgtccagccctc
aaacacggcgacttgcgtctctcccaaacaccaaacattcttctctatctcggacccaag
cttggcctggctcccaccaaaggcaacggcatctaccacatcaatcaaatagccttgacc
atcttggacggcttctccaatgaggtccacgacacacaccaccctgtagctgtgtcggat
tactacgaggcccagaagcccgaagccaagaggcgagccaagtcgtttattgaggagcgg
cttcccaagttccttgcctatatccagcgcgtactggatgggaaggcgagcggagatggc
ccgtggttgtacggcgggaagctgacatatgccgatttggtgctttttcagggcattgat
ggaacggaattcgccttccccaagactatgaagaagatgcgagattccggaaaatacgac
ggtgttttcaagctctacgaggttgtcaaggaacgacccaacatcaaggcatatcttgcc
agtgatcgccgctcccagtattctgacggtatttggaggcactatcccgaactggaggag
gactag

DBGET integrated database retrieval system