KEGG   Metarhizium acridum: MAC_09405Help
Entry
MAC_09405         CDS       T03104                                 

Definition
(RefSeq) sorbitol dehydrogenase
Organism
maw  Metarhizium acridum
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Shikimate_DH ADH_N_assoc FAD_binding_3 NAD_binding_7 Sacchrp_dh_NADP 2-Hacid_dh_C ThiF Pyr_redox
Motif
Other DBs
NCBI-GeneID: 19253716
NCBI-ProteinID: XP_007815745
UniProt: E9EHQ7
LinkDB All DBs
Position
Unknown
AA seq 390 aa AA seqDB search
MATTTATADTTLVGTIRATAVSAPPPRQTMKAVRFHGKRDIRLDTIAAPKVGPGKVKIAP
KFCGICGSDLHEYLGGANLIPKPESPHPITNETFPLTLGHEFSGIVQEVGEGVESVKPGD
RVCVQPIIYDGDCRSCVRGLVNCCDQNGFVGLSGWGGGLCETMVVPDSCVKQLPDNVSLE
EGALVEPLAVGWHAVDISPFKETDSVLILGAGPIGLAVVQVLVGRGCKNIIVTEVSSKRR
DFATQFGAHHTIDPINENMVERVEELTGGLGADVAFDAAGAQAALDTAFDALKARGTLVN
IAVWEKRANLAMNGLVFRERGYMGVATYSLGDFEAVLDAISTGKIKPASMITKTIKLDQV
VEEGFHALINDKENQVKILVDVGAGLSTSS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgacggctaccgccgacacgactctggtcggcactattcgtgccacagct
gtctctgcaccccctcctcggcagaccatgaaggctgttcgcttccacggcaaacgtgac
attcgtcttgacactattgctgcccccaaagtcggccctggaaaggtcaagattgctccc
aagttctgcggaatctgcggatcagacctccacgagtatcttggcggagccaacctgatc
cccaagcctgaaagcccacaccccatcaccaacgagactttccctcttacccttggccat
gagttttctggtattgtccaggaagtcggcgagggcgtggagtctgtcaagcctggagac
cgtgtctgtgttcagcctatcatctacgacggggactgtcgctcttgcgtcagaggactt
gtcaactgctgtgatcaaaacggttttgttggcctcagtggatggggcggtggcttgtgt
gagaccatggttgttcccgactcttgtgtcaaacagcttcccgacaacgtttcactcgaa
gagggcgctctcgttgagcctcttgctgtgggctggcatgccgtcgacatttcccccttc
aaagagaccgacagtgtcctgatcctcggtgctggtcccattggcctggccgtcgtacag
gtcttggtaggacgcggctgcaagaacatcatcgtcactgaagtcagcagcaaacgaaga
gattttgcaacccagttcggagcacaccacaccattgaccccatcaatgagaacatggta
gaaagagtggaggaactcaccggtggtcttggtgcagacgttgcttttgatgctgccggt
gctcaagctgccctcgacactgcgtttgacgcactcaaggcccgtggcactctggtcaac
attgctgtgtgggaaaagcgagccaacttggccatgaatgggcttgttttccgcgagaga
ggatacatgggagttgctacctacagtctcggagactttgaggcagttttggacgcaatt
tcgactggcaagataaagcctgccagcatgattaccaaaaccatcaagctagaccaggtt
gtcgaggaaggctttcacgccctcatcaatgataaagaaaaccaggtcaagattcttgtc
gatgttggtgccggtctgtccacctcttcataa

DBGET integrated database retrieval system