KEGG   Metarhizium acridum: MAC_09504Help
Entry
MAC_09504         CDS       T03104                                 

Definition
(RefSeq) putative glucoamylase GMY2
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
maw  Metarhizium acridum
Pathway
maw00500  Starch and sucrose metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAC_09504
Enzymes [BR:maw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MAC_09504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19253815
NCBI-ProteinID: XP_007815844
UniProt: E9EI06
LinkDB All DBs
Position
Unknown
AA seq 581 aa AA seqDB search
MYKNLISVLAVAGLWLDGAVAHRDDLHGFITKQKSISLHGVLANIGSDGSRAQGAAAGAV
VASPSKSDPDYWYTWSRDSALTFKVLIELFIGGKKSLQPKIEQYITAQAHLQGVSNPSGG
PDTGGLGEPKFHVNLTAFTGSWGRPQRDGPPLRATALTIYANWLIANGGQAEAANTVWPI
IAKDLSYTVQYWNRTGFDLWEEINGSSFFTLSASFRALVEGATLAKALGKQCPDCETNAP
RILCFLQSFWANGYIDSNINVNDGRTGKDVNSIISSIHTFDPAAACTDATFQPCSSRALA
NHKAVVDSFRTIYTVNKGRRPGRAAAVGRYSEDVYYNGNPWYLATMAAAEQMYAAVYQWR
EIGSITVDATSLPFFSDLIPNIAAGTYAKNSATFTSIIKAATAYGDDFVRVVKQYTPADG
SLAEQYDRETGSPKSAVHLTWSYASFVGAVERRSGIVPPSWGEPNSNTVPKVCEAPPSCD
STMTFNVKVTTVPGESIYVVGSITELKNWSPADAVPLDASQYTPSNPLWSAKVTIPAGTN
FEYKYIKKTSDGTVVWESDPNRSATSSTGCQSNGTLNDQWR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaacctcatcagcgtgctggctgtggctggcctgtggctggatggagccgta
gcccaccgagacgacctacatggcttcatcaccaaacagaagagtatttcccttcatgga
gttttggccaatattggctctgatgggtcaagggcccagggtgccgcggctggcgctgtc
gtagccagcccaagcaagtcggatccagactactggtatacttggagccgggactctgcc
ttgactttcaaagtcttgatcgagctctttatcggtggaaagaagtctctgcagcccaag
attgagcagtacatcaccgcccaggcgcatctacaaggcgtgtccaatccttcgggcgga
ccagacacgggcggtttgggagagcccaagttccatgtcaatctcacagcctttactggt
tcctggggtaggccgcagcgcgatggtccccctttgcgagcaactgctctcaccatctat
gccaactggctcattgccaacgggggccaggccgaggctgcaaacaccgtctggcccatt
attgccaaagacctgtcatacacggttcagtattggaaccgaaccggctttgatctatgg
gaggaaatcaacggctcttctttctttactctgtccgcctcatttcgcgctctggtcgaa
ggcgctaccctcgccaaggcactcggcaagcagtgcccggattgcgaaaccaacgccccc
aggatactctgcttccttcaaagcttctgggccaatggctatatcgactccaacatcaac
gtcaacgatggccggaccggcaaggacgtcaactccatcatctcatccattcacacgttt
gaccctgcagctgcctgcacggatgcgaccttccagccgtgttcatccagggccttggca
aatcacaaggcagttgtcgattcctttcgtaccatttataccgttaacaagggccggaga
cctggcagggcagctgccgtaggccgctactcggaagatgtatactacaacggtaaccct
tggtacttggccacaatggcagccgccgagcagatgtacgctgccgtctaccagtggcgg
gagattggctccattaccgtggacgctacatctctccctttcttcagtgacctgatacca
aatatcgctgccggcacttatgccaagaactctgctacctttacctccatcatcaaggca
gcgacggcttatggagatgactttgtcagagttgtgaagcaatacactcccgccgatggc
tccctggccgagcagtacgaccgagaaacaggaagccccaagtctgctgttcacttgact
tggtcctacgcatcatttgtcggagctgtcgagcgcagatctggcattgttccaccctcg
tggggagagcccaactccaataccgttcccaaagtttgcgaggctcctcctagctgtgac
tccaccatgaccttcaacgtcaaggttaccacggtccccggagagagcatctatgtcgtt
ggttccattaccgagttgaaaaattggtcgccggctgatgcagtccccttggatgcttca
caatacacccccagcaacccactttggagcgcaaaggtcacgattcctgccggtacaaac
tttgagtacaagtatatcaagaagacgagcgacgggacggttgtgtgggagagtgatccc
aatcgtagcgcgacatcctctactggatgccagagcaacgggacgctgaatgatcagtgg
agatga

DBGET integrated database retrieval system