KEGG   Candidatus Methanomethylophilus alvus: MMALV_11260
Entry
MMALV_11260       CDS       T02624                                 

Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
max00300  Lysine biosynthesis
max01100  Metabolic pathways
max01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:max00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MMALV_11260
Enzymes [BR:max01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MMALV_11260
SSDB
Motif
Pfam: THF_DHG_CYH_C 2-Hacid_dh_C Shikimate_DH NAD_binding_2 Mrr_cat ADH_zinc_N NAD_binding_7 F420_oxidored Sacchrp_dh_NADP AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AGI85859
UniProt: M9SDR3
LinkDB
Position
complement(1112731..1113534)
AA seq 267 aa
MISGLSDGLSDIDRMLMRDTGMNLLTLGFRAIGADASEVDVKRFKAASVPITSGLGIIGG
FSRSVADIVRDMGIDCFVTEHTDVWGFGEAIDRGADIILMADDEQYMAYSVAAGRYANNS
FCTAAGYVEALRGAVGGLQGKEVFVRGAGRVGSNMVSLLCAQGARPIVADVIREKAEAVA
RANPGATAAEDLEEATAEAGLILNASPVPIPGDLIREGAVVSTPGIPHVYDEATLRKAKF
IHDPLAIGTAPMVAQCIIYTMDKEREQ
NT seq 804 nt   +upstreamnt  +downstreamnt
atgatatcgggcctctcggacgggctcagcgacatagaccggatgctcatgagggacacc
gggatgaacctgctgaccctcggattccgtgccataggggcggacgcctccgaagtggac
gtcaaaagattcaaggccgcatcggtgcctataacatcgggtctcggtataatcggcggt
ttctccagatctgtggcggatatcgtccgcgacatggggatcgactgtttcgtgaccgag
catactgacgtctggggcttcggagaggccatcgacagaggggccgacataatactgatg
gccgacgacgagcagtacatggcatacagcgtcgccgccggaagatacgccaacaactcg
ttctgtaccgcggctggctatgtggaagccctcaggggtgccgtgggcggcctgcagggg
aaggaggtgttcgtccgcggggccggaagggtcgggagcaacatggtctccctgctctgc
gcccaaggtgccagaccgatagtcgcggacgtcatcagggagaaggcggaggccgtggcg
agggcgaatccgggtgctacagcagcagaggacctggaggaggccaccgccgaggccgga
ctgatactcaacgcgtcaccggttccgatacccggtgacttgatacgggagggggcggtg
gtgtccacaccgggcataccgcatgtgtacgacgaggccaccctcaggaaggccaagttc
atccacgacccgctcgccatcggtacggcaccgatggtggcccagtgtatcatctatacc
atggataaggagagagaacaatga

DBGET integrated database retrieval system