KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_01410Help
Entry
LA62_01410        CDS       T03353                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIR36370
LinkDB All DBs
Position
complement(278219..279283)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPE
LVAAVLAELPPRCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLL
ALGDEDYTGRPFSERRAALTEALSSAGTSIHLTPATTDQALAQRWFEEFEGAGTDGLIAK
PLAIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQEDGILASVGVIG
AFPMAERKRLFQELQPLIIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctccaatcgcgccaatgcttgccaaacctgtcgcaaaaatc
cctgacggcgcctcctacgaacccaagtgggatggattcaggtcgatcgtctttcgcgac
ggcgacgaggtggagctgggtagccgcaatgagaagccactgacccggtacttccccgag
ttggtagcggcggtgctcgccgaactaccgccacggtgtgtcgtcgacggtgagatcgtg
atcgccaccgaggcgggtctggatttcgaggcgctgcaacaacggatccacccggcggat
tcgcgggtacggctgttggccgagcagacaccctcctccttcatcgcattcgacctgctc
gccttgggcgacgaggactacaccgggcggcccttcagcgagcgccgtgccgcgctgacg
gaagcgctctcgagtgccgggacctcgatacatctgacccccgccaccacagatcaggca
ctggcgcagcgctggttcgaggaattcgagggcgccggtaccgacggtctcatcgccaaa
ccgttggccatcgcctaccaacccgacaaacgagtgatgttcaagatcaagccggagcga
accgccgattgcgtggtcgcgggctaccgagtgcacaaatcgggtgacgatgccatcggc
tcgctgctgctgggcctgtaccaggaggacggcatattggcgtcggtcggtgtgatcggc
gcgttccccatggccgaacgcaagcgcctattccaagaactgcaaccgttgatcatcccg
ctcgaaaatcacccgtggaactgggccgcacacgaagccggcgagcgcactccgcagaag
aacgccggctcccgctggaacgcgggcaaggatctttcgtttgtcccgctgcgtcccgag
cgagtggtggaggttcgctacgaccacatggagggtgtgcggttccgtcataccgcgcag
ttcaaccgctggcgcccggatcgcgacccgcgatcctgcacctacgagcagctagaacaa
ccaattacattcagcctcaacgatatcgttccaggtctggtgtga

DBGET integrated database retrieval system