KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_21825Help
Entry
LA62_21825        CDS       T03353                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
Pathway
may00290  Valine, leucine and isoleucine biosynthesis
may01100  Metabolic pathways
may01110  Biosynthesis of secondary metabolites
may01130  Biosynthesis of antibiotics
may01210  2-Oxocarboxylic acid metabolism
may01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:may00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA62_21825
   00290 Valine, leucine and isoleucine biosynthesis
    LA62_21825
   00220 Arginine biosynthesis
    LA62_21825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:may01007]
    LA62_21825
Enzymes [BR:may01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LA62_21825
    2.6.1.66  valine---pyruvate transaminase
     LA62_21825
Amino acid related enzymes [BR:may01007]
 Aminotransferase (transaminase)
  Class I
   LA62_21825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR40330
LinkDB All DBs
Position
4367344..4368654
Genome map
AA seq 436 aa AA seqDB search
MDSNATIETVSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLE
AEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVD
GFPYLDVDDVFLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLC
DETNGWMPDIEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADE
IYDKILYDDAEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGV
NLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKP
QGALYAFPRLDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDL
AVAIERLGNFLASYRQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcaatgccaccattgagaccgtgagtaccgataacttgccgattgacgtgccc
ccgcgcgtgcccggcctctcgccgcggcagcaccagcgggtcttcgcgcagtccaccaag
ctacaagacgtcctgtacgaaatcaggggtccggtacacgcgcacgccgcccggctcgag
gctgaggggcaccgcatcctcaagctcaatatcgggaaccccgcgccgttcggattcgag
gcgcccgatgtcatcatgcgcgacatcatccaggcgctcccctacgcacagggctactcc
gactccaagggcatcctgcccgcccggcgcgcggtggtcacccgctacgaactggtcgac
gggttcccgtacctggatgtggacgacgtctttctgggcaatggggtatccgagctgatc
accatgaccacccaggcgctgctcgacaacggcgaccaggtgctcatcccggcgcccgac
tatccgttgtggaccgccgcgacctcacttgccggcggcaccgcggtgcattacctgtgc
gacgagaccaacggctggatgcccgatatcgaggatctggaatccaagatcaccgagcgc
accaaggccctcgtcatcatcaacccgaacaacccgaccggcgcggtatacagccgcgag
atcctcacgaagatggtcgaactggcccgcaagcatcagttactgctgctggccgacgag
atttacgacaagatcctgtacgacgacgccgagcacatcagcgttgcgtcactggcgccg
gatctgttgtgtttcaccttcaatggcctgtccaaggcatatcgagtggccggctaccgg
tcagcatggcttgctatcaccgggcccaaggaccacgccgccagcctgttggaaggcgtg
aacctgctggccaatatgcgactgtgcccgaatgttcctgcccagcatgcgattcaggtg
gccctcggcggacaccagagcatcgaggatctggtgctaccgggcggtcgcctgctggag
cagcgcgatgtcgcctggacaaagctcaacgagatccccggtgtctcctgcgtcaagccg
cagggtgcgctctacgcgttcccgcgcttggaccccgaggtgcaccatatccacgacgac
gaccagctcgtgctggatctgctgctcaacgagaagatcctgctgacgcagggtaccggc
ttcaattggcctgagccggaccatcttcggatagtcacgttgccgtgggcccgcgacctt
gccgtcgccatcgagcgcctgggtaacttcctggcgagctaccgccagtag

DBGET integrated database retrieval system