KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_21825Help
Entry
LA62_21825        CDS       T03353                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
Pathway
may00220  Arginine biosynthesis
may00250  Alanine, aspartate and glutamate metabolism
may00290  Valine, leucine and isoleucine biosynthesis
may01100  Metabolic pathways
may01110  Biosynthesis of secondary metabolites
may01130  Biosynthesis of antibiotics
may01210  2-Oxocarboxylic acid metabolism
may01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:may00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA62_21825
   00290 Valine, leucine and isoleucine biosynthesis
    LA62_21825
   00220 Arginine biosynthesis
    LA62_21825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:may01007]
    LA62_21825
Enzymes [BR:may01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LA62_21825
    2.6.1.66  valine---pyruvate transaminase
     LA62_21825
Amino acid related enzymes [BR:may01007]
 Aminotransferase (transaminase)
  Class I
   LA62_21825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR40330
LinkDB All DBs
Position
4367344..4368654
Genome map
AA seq 436 aa AA seqDB search
MDSNATIETVSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLE
AEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVD
GFPYLDVDDVFLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLC
DETNGWMPDIEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADE
IYDKILYDDAEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGV
NLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKP
QGALYAFPRLDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDL
AVAIERLGNFLASYRQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcaatgccaccattgagaccgtgagtaccgataacttgccgattgacgtgccc
ccgcgcgtgcccggcctctcgccgcggcagcaccagcgggtcttcgcgcagtccaccaag
ctacaagacgtcctgtacgaaatcaggggtccggtacacgcgcacgccgcccggctcgag
gctgaggggcaccgcatcctcaagctcaatatcgggaaccccgcgccgttcggattcgag
gcgcccgatgtcatcatgcgcgacatcatccaggcgctcccctacgcacagggctactcc
gactccaagggcatcctgcccgcccggcgcgcggtggtcacccgctacgaactggtcgac
gggttcccgtacctggatgtggacgacgtctttctgggcaatggggtatccgagctgatc
accatgaccacccaggcgctgctcgacaacggcgaccaggtgctcatcccggcgcccgac
tatccgttgtggaccgccgcgacctcacttgccggcggcaccgcggtgcattacctgtgc
gacgagaccaacggctggatgcccgatatcgaggatctggaatccaagatcaccgagcgc
accaaggccctcgtcatcatcaacccgaacaacccgaccggcgcggtatacagccgcgag
atcctcacgaagatggtcgaactggcccgcaagcatcagttactgctgctggccgacgag
atttacgacaagatcctgtacgacgacgccgagcacatcagcgttgcgtcactggcgccg
gatctgttgtgtttcaccttcaatggcctgtccaaggcatatcgagtggccggctaccgg
tcagcatggcttgctatcaccgggcccaaggaccacgccgccagcctgttggaaggcgtg
aacctgctggccaatatgcgactgtgcccgaatgttcctgcccagcatgcgattcaggtg
gccctcggcggacaccagagcatcgaggatctggtgctaccgggcggtcgcctgctggag
cagcgcgatgtcgcctggacaaagctcaacgagatccccggtgtctcctgcgtcaagccg
cagggtgcgctctacgcgttcccgcgcttggaccccgaggtgcaccatatccacgacgac
gaccagctcgtgctggatctgctgctcaacgagaagatcctgctgacgcagggtaccggc
ttcaattggcctgagccggaccatcttcggatagtcacgttgccgtgggcccgcgacctt
gccgtcgccatcgagcgcctgggtaacttcctggcgagctaccgccagtag

DBGET integrated database retrieval system