KEGG   Mycobacteroides abscessus subsp. bolletii 103: LA61_12770Help
Entry
LA61_12770        CDS       T03329                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
maz  Mycobacteroides abscessus subsp. bolletii 103
Pathway
maz00380  Tryptophan metabolism
maz00630  Glyoxylate and dicarboxylate metabolism
maz01110  Biosynthesis of secondary metabolites
maz01130  Biosynthesis of antibiotics
maz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:maz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LA61_12770 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    LA61_12770 (katE)
Enzymes [BR:maz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     LA61_12770 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIR33695
LinkDB All DBs
Position
complement(2561795..2563903)
Genome map
AA seq 702 aa AA seqDB search
MDRTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREIVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
STKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQRDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQPRMFWNSMSAVEAQHIVSAFSFELGKVSAEAG
IRERVVAQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSTTRDSIATRRIA
VLAADGVDIHGVELLRAALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGSGLDLLRAASVVETLATTTEIV
VDDGVVTTTAEANALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcacgtcgaatcccaaacaagagcaactcgacacgtcccgggtggaccgagcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggtgtcaggggccccacgctgctggaggattttcacgcccgcgagatagtcacgcat
tttgaccacgagcgcattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tacttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcggggtcccgcggctcg
gcagacaccgtgcgcgacgtacgcggatttgccacgaaattctatacacagcaaggcaat
tacgatctggtcggcaacaatttcccggtattctttatccaggacggcatcaaatttccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgttgccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccggttggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctgggcgtgcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgattgagtccggccagtttccggaatgggaa
ctcggagtgcagctggtgccggaatccgacgagttcaaattccccttcgaccttcttgat
tcaacgaaaatcattccggaagaacaggttccggtgcagccggtcggacgcatggtgctg
gatcggaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaac
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctgggcggtccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtacacaacaaccagcgagacggcttcgcgcagcatgacatcccacaa
ggcaagtccagctatttcaagaacaccctcggcggcggctgtccggccctggcacatgaa
gatgtcttccgccactacacccaacgagtggacggacataagatccgccagcgcgccgag
agcttcaaggatttctacagccagccgcggatgttctggaacagtatgtccgccgtcgag
gcgcagcacatcgtttcggcattctcgttcgaactgggcaaggtgagtgccgaggccggg
attcgcgaacgtgttgtcgctcaactcaacctggtggaacacgatcttgcttctcaagtc
gccttgcagctgggcttacccgccccagcgccgcaatcggccgacgaggctcttccaccg
tccccggcgctgtcccagctttccaccacccgagacagcatcgccacccgacggatcgcg
gtgctcgcggccgacggcgtcgatattcacggcgtggagttgcttcgtgcggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccacgatggcctcggtgttatacgac
gccgtagtcgtaccctccggagccgaatccgcctggcggctggcgcgcaacggcttcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggttccgga
ctcgatctgctccgggcagcctctgtggtcgaaacacttgccaccaccacggagattgtg
gttgacgacggcgtggtgacgaccaccgcggaggccaatgcattgccggccgaattcgtg
gccgcgtttgtcacagcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system