KEGG   Methanosarcina barkeri Fusaro: Mbar_A0835
Entry
Mbar_A0835        CDS       T00271                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00300  Lysine biosynthesis
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mbar_A0835
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mbar_A0835
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: AAZ69812
UniProt: Q46E80
LinkDB
Structure
PDB: 

Position
1:complement(1009602..1010393)
AA seq 263 aa
MAIKMALLTPDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPVTSG
NGIIGNFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDRTFLAHNLKNG
KMANNQPCTGIIYAEIASRYLKADSKDVLVVGLGKVGFPGAEHLVQKDFRVYGYDADETL
LERATSNLGIIPFDPANPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELRD
KYEVQLIAEPLGIGTASMLYSVL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgataaaaatggcactcttaactcccgatgatttgataaacattaatatgcaactt
cagaaagctgactctgctgtgcaagaagtaacggggcttgatataaaaggtatttgcaag
gctctctacggtactttctcgagctccgaaaaagtaggcatcgtgcctgtaacttcggga
aacggaattataggaaacttttcggcttccctgcatgcaattacgcagtatttcggattt
gacagttttgttacggatatgccggatgttagcggctattatgaagctgtgcagaacgga
gccgagatcatccttatggcagacgaccgcactttccttgcccataacctcaaaaatgga
aaaatggccaataatcaaccctgcacaggtattatctatgctgagatcgcttccagatat
ctgaaagccgactcaaaggatgtacttgttgtggggcttgggaaagtaggtttccccgga
gccgagcatttagtgcagaaagactttagggtttacgggtatgatgctgatgaaactctc
cttgagagagccacttcaaacctcgggattattcctttcgaccctgcgaatccgaaaaaa
ttttccattatattcgaggcgactccatgcgcaaacacgattcctgaagccgtactttcg
gagaattgcgtgctttccactcctggaatcccctgcgcaatttctgaagagcttagagat
aaatacgaagtacaacttatagcggaaccccttggaataggaactgcatcaatgttgtac
tctgtgctataa

DBGET integrated database retrieval system