KEGG   Methanosarcina barkeri Fusaro: Mbar_A1170Help
Entry
Mbar_A1170        CDS       T00271                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K13831  3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC:4.1.2.43 5.3.1.27]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00030  Pentose phosphate pathway
mba00680  Methane metabolism
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
mba01200  Carbon metabolism
mba01230  Biosynthesis of amino acids
Module
mba_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mbar_A1170
  09102 Energy metabolism
   00680 Methane metabolism
    Mbar_A1170
Enzymes [BR:mba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Mbar_A1170
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     Mbar_A1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like OMPdecase HMGL-like His_biosynth NanE ADH_zinc_N Ribul_P_3_epim ThiG Trp_syntA DUF4410
Motif
Other DBs
NCBI-ProteinID: AAZ70138
UniProt: Q46DA4
LinkDB All DBs
Position
1:1436305..1437546
Genome map
AA seq 413 aa AA seqDB search
MDRAVEIAKEAIAGGADWIEIGTPLIKSEGMDAIRTMRKAFPDRTILADMKTVDTGAIEV
EMAAKAGADVVIVLGSADDSTLLDALRSSHKYGVRLMADLISAPDPVKRVVELEALGVDY
VNVHIGIDQQMMGKDPIALLREISQRVNVQLAVAGGLDANSAVQAVKAGAKVVIVGGNIT
HSDNVTEAARKIRQSVDSPDAVEICSVSTVDQEIREILKEVSTSNISDAMHRKGAMKGIH
PLVRGKMVGTAVTVQTFPGDWAKPVEAIDIAKEGDVIVIYNENKDVACWGGLATWSALNK
GIAGLVIEGAVRDIDEVETLGLPIYTSNTVPNAGDPKGFGEINAEITCGGQAVKPGDYIV
GDESGVVVIPAERAYELARRAKEVYKTEKRLFDEIKRGGTLSEIMDLKKWEKH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgtgcggtagagattgcaaaagaggcaatagcagggggtgcggactggatagaa
attggaacccctctgatcaaaagtgaggggatggacgcaatccgcaccatgaggaaagct
tttccagatcggacgattctggcagacatgaaaactgtagatacaggcgctatagaagtc
gagatggcagcaaaagctggagctgatgttgttattgtgctagggagtgcagatgattct
acattacttgacgcactccgttcatcccacaaatatggagtcaggttaatggcagaccta
atttcggctcctgatcctgtaaagagggtcgttgaacttgaggctctgggcgtggactat
gttaatgtacacataggaatagaccagcagatgatgggaaaagatcccatagcacttctc
agggaaatttcacagagagtcaacgtacagcttgcagtcgctggtgggcttgatgcaaat
agtgcagtgcaggctgtcaaagctggagcaaaggtcgtaattgttggagggaatatcacc
cattctgacaacgtaaccgaagccgccagaaaaatccggcagagtgtggactccccagac
gctgtagaaatctgcagtgtcagcactgtagaccaggaaatcagagaaattcttaaggaa
gtatccacttcaaatatttctgatgccatgcaccggaaaggtgcaatgaaaggcattcac
cctctggtaagaggaaaaatggtaggaaccgcagttaccgtgcagacttttcctggagac
tgggcaaagcccgtggaagcaattgatattgcaaaagaaggagacgtaatcgttatttac
aacgaaaataaggatgttgcctgttggggagggcttgcaacctggagcgccttgaacaag
ggaattgcaggtttggtaatagaaggcgctgtcagagatattgacgaagtcgaaaccctg
ggacttccgatttatacgagcaataccgtacctaacgccggagatcctaaaggttttgga
gaaatcaatgctgaaattacctgtggtggtcaggccgtgaagccaggagattatatagtg
ggcgatgaaagcggtgttgtggtaattccagcagagagagcatacgagctggcaagaaga
gcaaaagaagtttacaaaaccgaaaaaagactcttcgatgaaatcaagagaggcgggaca
ctgtctgagattatggatctgaagaagtgggaaaaacattga

DBGET integrated database retrieval system