KEGG   Candidatus Methylopumilus turicensis: BN1209_0700Help
Entry
BN1209_0700       CDS       T03844                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbac  Candidatus Methylopumilus turicensis
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN1209_0700 (ahpF)
Enzymes [BR:mbac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN1209_0700 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_3 FAD_oxidored FAD_binding_2 Thi4 K_oxygenase DAO NAD_binding_7 Glutaredoxin AlaDh_PNT_C Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CEN55744
UniProt: A0A0B7IU29
LinkDB All DBs
Position
1:664855..666408
Genome map
AA seq 517 aa AA seqDB search
MALDSNIKNQLSAYMEKLLHPIAIVASVDGSPKSNEMMDLLTELAGMSEKIHLTEEQDQR
TPSFAIKRFEAGAAPVGIRFAGIPMGHEFTSLILALLQVGGHPLKLEAEKIAQIAAIEGS
FHFETYISLSCHNCPDVVQALNLMAVINLNITNVMIDGGVFQQEVTDKKIMSVPTVMLNG
EQFGVGRMELDEILAKVDVGAVAREAKKLDAKAPYDVLIIGGGPAGASAAIYSARKGIRT
GIVAERFGGQVMDTLGIENFISVKETEGPKLVMALEEHVKFYDVDIMNLQRAKSVKQGDL
LEVELESGAVLKSKALVIATGARWRELGVPGEAQYRGKGVAYCPHCDGPLFKGKPVAVVG
GGNSGVEAAIDLAGIVAHVTLIQFDPELKADAVLQTKLRSLSNVTIVTNAQTTEVTGNGE
KMNGLDYKDRATGEMHHLDLDAVFVQIGLLPNTDFIKGGPINLSKFGEIEIDSHGATSMP
GVYAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctttagacagcaatatcaaaaatcaactctcagcctatatggaaaagctgctacat
ccaattgcgattgtcgcatccgtcgatggtagccccaaatccaatgagatgatggatttg
ctgactgaattagctggtatgtcagaaaagattcatctaactgaagaacaagatcaacgc
acgccatcttttgcgatcaaacgctttgaggcgggtgctgcgcccgtgggaattcgcttt
gcaggcatcccaatggggcacgaatttacttcattgattttggctttgctccaagtgggc
ggccatcctttgaaattagaagctgaaaaaatcgcacaaattgccgcgattgaaggtagc
ttccattttgagacttatatttctttaagctgccataactgccctgacgtggtgcaggct
ttgaacttgatggcagtgattaacctaaacatcacgaacgtgatgattgatggcggtgtg
ttccagcaagaagtgactgacaaaaagattatgtctgtaccaaccgtgatgctcaatggc
gaacagtttggtgtgggtcgtatggagcttgatgagattttagccaaagtggacgtgggc
gctgtggcccgtgaagccaaaaagctagatgcaaaagcgccttacgatgtattgattatt
ggcggcggcccagcaggggcttctgcggcgatttactctgcacgtaaaggcattcgcaca
ggcattgtggcggaacgctttggtggtcaggtcatggatacgcttggcatcgaaaacttt
atttcagtgaaagaaactgaaggccctaagttagtcatggcgctggaagaacacgttaaa
ttctacgatgtggatattatgaatttgcaacgtgcaaaatcggtcaagcaaggtgatttg
ctggaagtagaattagaaagcggtgcggttttaaaaagcaaagccttagtgatcgccact
ggcgcacgttggagagaattgggcgtgcctggtgaagcgcagtatcgcggtaaaggcgtg
gcttactgcccacactgtgatggccctttgtttaaaggcaagcctgttgcggtggtgggg
ggtggtaactcaggcgttgaagcggcgatcgatttagctgggattgtggcgcatgtgact
ttgattcagtttgacccggaattaaaagcggatgcagtgttgcagacaaagttacgttca
ctcagcaatgtgacgattgtgacaaatgcacaaacgacggaagtgaccggtaatggcgag
aagatgaacggcttagattacaaagaccgtgcaacaggggaaatgcatcatttagatttg
gatgcggtatttgtgcaaattggtttattaccgaatactgactttatcaaaggcggcccg
atcaacttgagtaagttcggtgagatcgagattgattcacacggcgcaacctctatgcca
ggcgtgtatgcggcgggcgatgtgaccactgtgccatacaagcaaattattatcgcgatg
ggtgagggcgctaaagcttcacttggggcatttgattacttgattcgtcaataa

DBGET integrated database retrieval system