KEGG   Candidatus Methylopumilus turicensis: BN1209_0771Help
Entry
BN1209_0771       CDS       T03844                                 

Gene name
rmpA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00030  Pentose phosphate pathway
mbac00680  Methane metabolism
mbac01100  Metabolic pathways
mbac01120  Microbial metabolism in diverse environments
mbac01200  Carbon metabolism
mbac01230  Biosynthesis of amino acids
Module
mbac_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN1209_0771 (rmpA)
  09102 Energy metabolism
   00680 Methane metabolism
    BN1209_0771 (rmpA)
Enzymes [BR:mbac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BN1209_0771 (rmpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CEN55814
UniProt: A0A0B7IU82
LinkDB All DBs
Position
1:758709..759341
Genome map
AA seq 210 aa AA seqDB search
MAHTQMALDSLDFDATVALATATAPHVDILEIGTPCIKHNGIKLLETLRAKFPNNKILVD
LKTADAGFYEAEPFFKAGADIVTVLGVSDIGTVKGVIDVANKYGKKAQVDLINVADKVAK
TKEVAKLGAHIIGIHTGLDQQAAGQTPFADLAAIAALNLGVEISVAGGVKAATTAQVRDA
GATIIVAGAAIYGAADPAAAAAEITAIAHA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacacaaatggcattagattcattagactttgacgcaacagttgcacttgct
acagcaactgcaccacacgttgacattcttgaaattggtacaccatgcatcaagcacaac
ggtatcaaattgcttgaaacacttcgtgctaaattcccaaacaacaaaatcttagttgat
ttgaaaacagctgatgctggtttctacgaagctgagccattcttcaaagctggcgctgac
atcgttactgtattgggtgtttcagacatcggcactgttaaaggtgtgatcgacgttgct
aacaagtacggcaaaaaagctcaagttgacttgatcaacgttgctgacaaagttgctaaa
actaaagaagttgcaaaattaggtgcacacatcatcggtattcacactggtcttgaccaa
caagctgctggccaaacaccattcgctgacttagctgctatcgctgctttgaacctaggt
gttgaaatctctgttgctggtggcgttaaagctgctacaactgcacaagtacgtgatgct
ggcgcgacaatcattgttgctggcgctgctatctacggtgctgctgatcctgctgcagct
gctgcagaaatcactgctatcgctcacgcttaa

DBGET integrated database retrieval system