KEGG   Candidatus Methylopumilus turicensis: BN1209_1529Help
Entry
BN1209_1529       CDS       T03844                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00473  D-Alanine metabolism
mbac00550  Peptidoglycan biosynthesis
mbac01100  Metabolic pathways
mbac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN1209_1529 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN1209_1529 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN1209_1529 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbac01011]
    BN1209_1529 (ddlB)
Enzymes [BR:mbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN1209_1529 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:mbac01011]
 Precursor biosynthesis
  Amino acid ligase
   BN1209_1529 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 TTL RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CEN56565
UniProt: A0A0B7IZN3
LinkDB All DBs
Position
1:complement(1506266..1507201)
Genome map
AA seq 311 aa AA seqDB search
MMSETFGKVAVLLGGKSGEREVSLKSGSAVLAALQAQGIDAEAFDPATRPLHDLAQYDAA
FISLHGRFGEDGTMQGALELFGIPYTGSGVMASAIGMDKWRTKLIWHAAGVTTPAFEVVS
ADSDFAAIEQKLGLPLFVKPANEGSSIGISKVKTAGGLKAAYELAAKSDPLVIAEQFVGG
GEYTVGILGDQVLPIVRIVPANEFYDFEAKYLRDDTQYLCPCGLPSAQEARIQAEALQAF
KAIGGTGWGRVDFLMDEAGKHYFLEVNTSPGMTDHSLVPMAAKAAGIPFGDLVKRILSLA
IAQHGAKTRVG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgagacatttggaaaagtagccgttttattgggtggaaaatcaggcgaacgt
gaagtttcgctcaagagcggctcggctgtgttagctgcattgcaagcgcaaggcatcgat
gcggaagcatttgatccagcgactcgcccattgcatgacttagcacaatatgacgcggct
tttatttcgctgcatggtcgctttggtgaagatggcaccatgcaaggcgctttggagttg
ttcggcatcccatatacaggctctggcgtgatggcttcagctatcggcatggataagtgg
cgtactaagttaatttggcacgcagcaggtgtaacaacgccggcatttgaagtcgtcagt
gcagattctgattttgcagccattgagcaaaaactgggcttgccactcttcgtcaaaccc
gctaacgaaggctcaagcattggcattagcaaagttaaaacagcagggggtttgaaagcc
gcttatgaattggcagctaaatcagacccgctagtcattgcagagcaatttgtaggcggc
ggcgaatatacagtgggtattttgggcgaccaagttttaccgattgtacgcatcgtgcct
gcgaatgagttttatgattttgaggctaaatatttacgtgatgacacgcagtatttatgc
ccatgtggtttgccatcagcacaagaagccagaatacaagcggaagctttacaggcattt
aaagcgattggtggcacaggttggggtcgtgtggatttcttgatggatgaagcgggcaag
cattactttttggaggtgaataccagtccgggcatgacagatcacagcttggtcccaatg
gccgcaaaagcggcagggattccatttggtgacttagtgaaacgtattttgagtttggca
atagcacagcacggagcgaaaacgcgtgtgggataa

DBGET integrated database retrieval system