KEGG   Candidatus Methylopumilus turicensis: BN1209_1712
Entry
BN1209_1712       CDS       T03844                                 

Gene name
metH
Definition
(GenBank) homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00270  Cysteine and methionine metabolism
mbac00450  Selenocompound metabolism
mbac00670  One carbon pool by folate
mbac01100  Metabolic pathways
mbac01110  Biosynthesis of secondary metabolites
mbac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN1209_1712 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN1209_1712 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BN1209_1712 (metH)
Enzymes [BR:mbac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     BN1209_1712 (metH)
SSDB
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding
Other DBs
NCBI-ProteinID: CEN56749
UniProt: A0A0B7J278
LinkDB
Position
1:1677222..1681073
AA seq 1283 aa
MTLFSPTEQILRDLLAKRILILDGAMGTMIQQYKLNEADYRGGENGRFKDFKGPAGAEFC
NKGSSCGCGANHNPAPTETTRELFVKGNNELLSLTQPHVIQEIHEQYFAAGADIVETNTF
GATTVAQDDYHMAHLAYEMNLASAKLALAARDKYSTPDKPRFVAGALGPTPKTASISPDV
NDPAARNVTFDQLVAAYLEQTRALVEGGVDILMVETIFDTLNCKAALFAIETFFEESGKR
LPLMISGTVTDASGRILSGQTVPAFWHSVRHAKPLTIGLNCALGAALMRPYAQELSKIAD
TFVCIYPNAGLPNPMSDTGFDEKPADTSALLKEFAENGFINIAGGCCGTTPPHIKAIADT
LKTIAPRQIPTVEKTTKLSGLEPFFIDDNSLFVNVGERTNVTGSKAFARMILNEQFEEAL
HVARQQVENGAQIIDINMDEGMLDAIKAMSHFLNLVASEPDIARVPIMIDSSKWDVIEAG
LKCVQGKSIVNSISMKEGEEEFLRQARLCMRYGAAIIVMAFDEKGQADTFERKIEICKRA
YDLLVDKVGFPAEDIIFDPNIFAIATGIEEHNNFAVDFINATRWIKENLPHAKISGGVSN
VSFSFRGNEPAREAIHTVFLYHAIKAGMTMGIVNAGMIGIYDDLPEALRECVEDVVLNRR
PDATERMIEMAGTLTAGGKKEAATLEWRGTPENPVSVQKRLAHALIHGITEFINEDTEEA
RVEALQNGGRPIHVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHLIPFIEE
EKLLEEKRTGVAAKPKGKMVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCSEIL
ALAKAENADIIGLSGLITPSLEEMAHVAREMQRDPYFRGLKTPLLIGGATTSRAHTAVKI
APHYDGPVVYVPDASRSVAVMQSLVSPEQRDAYITELNADYERARHQHANKKGVPMLSIE
DARQNKTKLAFTGNNAPVKPKFIGRRVLENIDLATIAQYIDWGPFFQTWDLAGAYPAILK
DPMVGETATKLFADGQALLKKIIEGRWLTANGVLSLLPANSVNEDDIEIYKDESRKEVAF
TYYGMRQQTEKPVIDGVPRPNQCLADFIAPKESGVEDYIGMFAVTAGLGIEKHLKRFEDA
HDDFNSIMLKSLADRLAEAFSEYLHERVRTDLWGYAAQEKLSCEALIKEEYQGIRPAPGY
PACPDHTVKADMFKVMQATEIGMSLTDAYAMNPAAAVSGYYFAHPEAKYFSVDKIGEDQL
TELAKRRGMNKEELARWLAPNLG
NT seq 3852 nt   +upstreamnt  +downstreamnt
atgacactgttttcccctaccgaacaaatcctgcgagatctattagccaaacgcattctc
atcttagatggtgcgatgggcacgatgattcagcaatacaagcttaacgaagcagactac
cgcggcggagagaacggtcgattcaaagattttaaaggcccggctggcgcggaattctgc
aataaaggctcctcttgcggttgtggcgcaaaccataatccagccccaacagaaaccacg
cgtgagctgtttgtaaagggcaacaacgagctattaagtcttacacaacctcacgtcatt
caagagatccacgaacaatatttcgcggctggcgcagacattgttgaaaccaatactttt
ggggcaaccactgtggcgcaagacgattaccacatggcccacttggcttacgaaatgaat
ttggcttctgccaagctagcccttgccgcacgagacaaatacagcacccctgacaagcca
agatttgtcgcaggcgctttaggcccaacacccaaaacggcttcgatttccccagacgtc
aacgatcccgctgcacgcaatgtgacttttgatcaactagttgccgcttatcttgagcaa
acacgcgctttggttgagggtggcgtagatattttgatggtggaaaccatctttgatacg
cttaactgtaaagccgcattatttgcgattgagactttcttcgaagaaagcgggaaacgt
ctaccgctaatgatttccgggacggtcaccgatgcttctggtcgtattttatctggtcaa
accgtgcccgctttttggcactcggttcgccacgcaaaaccactgactatcggcttgaat
tgtgcgcttggcgccgccttgatgcgcccgtatgcacaagagctttcaaaaatcgctgat
acttttgtttgtatttacccgaatgcaggtttgccgaatccaatgtcagacacagggttt
gatgaaaaacctgccgacacttcagccttactaaaagagtttgctgaaaacggctttatc
aatattgctggcggctgttgcggtacaacaccgccccacatcaaagcgattgctgacacg
ctaaaaacaattgcaccacggcaaattccaactgttgaaaagacgactaaactttctggg
cttgagccgttcttcattgacgacaattcactctttgtaaacgtcggtgagcgaactaat
gtcactggctcaaaagcttttgctcgcatgattttgaacgagcagtttgaagaagcactt
catgtggcacgccaacaagttgaaaacggcgcacaaatcatcgacatcaacatggatgaa
ggcatgttagatgccatcaaggccatgtctcacttcttgaacttggtcgcgtcagaacct
gatattgcacgtgtgccgattatgatcgactcatcgaagtgggacgtcattgaggccggc
ctcaaatgtgtgcaaggcaaatcgatcgttaattcaatctcgatgaaagagggcgaggaa
gagttcttacgccaagccagattatgcatgcgctatggcgcagcaattattgtgatggcc
tttgatgaaaaaggccaagcggacacgtttgagcgcaaaattgaaatttgcaaacgcgct
tatgacttactcgtcgataaagttggcttccctgctgaagacattatttttgacccaaac
atttttgcgattgcaaccggcatcgaagaacacaacaacttcgccgtcgatttcatcaat
gccacgcgctggattaaagaaaatctaccgcatgccaaaatttctggcggggtgtcaaac
gtaagctttagcttccgtggtaacgagcccgcccgcgaagcgattcataccgtgtttcta
tatcatgcgattaaagccggcatgacgatgggcatcgtcaatgcgggcatgattggtatc
tatgatgacttgccagaagccttgcgtgagtgcgtagaagatgtcgtgctcaaccgtcgc
ccagatgcaacagaacgaatgattgaaatggcgggcacactgactgctggtggcaaaaaa
gaagccgcgacacttgagtggcgtggtacgccagaaaatcctgtcagcgttcaaaaacgt
ttagcccacgctctcattcatggcatcactgaattcattaatgaagatacagaagaagcg
cgtgttgaagcgttacaaaacggcggccgacccattcatgtgattgaaggcccactcatg
gatggcatgaacatcgtgggagatttgttcgggcaaggcaaaatgttcttaccccaagta
gtgaagtcagcccgcgttatgaaacaagcagttgcgcacctcattcctttcattgaggaa
gagaaacttttagaagaaaaacgcacaggcgtcgccgcaaaaccaaaaggcaaaatggtc
attgcaaccgtcaaaggtgacgtgcatgacatcggcaaaaacatcgtttccgtggtttta
caatgcaataacttcgaagtcgtgaacatgggcgtaatggtgccatgttcagaaatctta
gccttagctaaagctgaaaatgcagacatcattggcttatctggcttgattaccccatca
cttgaagaaatggcgcatgttgcccgcgaaatgcaacgtgatccttatttccgcggactt
aaaacaccactcttaattggtggcgcaacgacatcacgcgcccataccgcggtaaaaatc
gcaccgcattatgatgggcccgtggtgtatgtgccagatgcctctcgttccgttgccgtc
atgcaatcactcgtatcgccagaacaacgcgacgcttatattacagaactgaatgcagac
tacgaacgtgctcgtcatcaacacgccaacaaaaaaggcgtgccgatgttgtcgattgaa
gacgcacgtcaaaataaaaccaagcttgcattcacggggaataatgcgcccgtcaaacct
aagtttattggtcgccgtgtattagaaaatattgatttagccacgattgcccaatacatc
gattggggtccttttttccaaacttgggatttagcaggggcttacccggcaattcttaaa
gatcctatggtgggtgaaactgcgacaaaattatttgccgacggccaagcgctgctcaag
aaaatcattgaaggccgatggctcacagcgaatggcgtactttcattattgccagccaat
agcgtgaatgaggacgacatcgaaatctataaagatgaaagccgcaaagaagttgcattt
acttattacggcatgcgccaacaaacagaaaaaccagtcatcgatggcgtacctcgcccg
aaccaatgcctcgcagacttcatcgcacccaaagagtctggtgttgaagattacatcggc
atgtttgcagtgactgctggcctcggtattgaaaaacatcttaaacgcttcgaagatgct
catgatgactttaatagcatcatgctgaaatcattggctgaccgtttggctgaggccttt
tcagaatatctacatgaacgtgtccgcacagatttgtggggatatgcggcacaagaaaaa
ctgagttgcgaagctttgattaaagaagagtatcaaggcattagaccagcacccggctat
cccgcttgtcccgaccataccgtcaaagccgacatgtttaaagtgatgcaagcgacagaa
attggcatgtcactgaccgacgcttacgcaatgaacccagctgcagcagtttctggttat
tattttgcacaccctgaagccaagtactttagtgtggataaaattggtgaagatcaactc
accgagttagctaaaagacgtggcatgaataaagaagaattggcacgctggctcgcccct
aatttaggctaa

DBGET integrated database retrieval system