KEGG   Candidatus Methylopumilus turicensis: BN1209_1731Help
Entry
BN1209_1731       CDS       T03844                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00970  Aminoacyl-tRNA biosynthesis
mbac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN1209_1731 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mbac03029]
    BN1209_1731 (gatB)
Enzymes [BR:mbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN1209_1731 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN1209_1731 (gatB)
Mitochondrial biogenesis [BR:mbac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN1209_1731 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: CEN56768
UniProt: A0A0B7J1Z0
LinkDB All DBs
Position
1:1698328..1699770
Genome map
AA seq 480 aa AA seqDB search
MEWEVVIGLETHTQLQTKTKIFSGASTAFGSEPNTQACVVSLAFPGVLPVLNQEAVKCAI
KFGLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGSMTIQVGSGDKAYEKVI
NITRAHLEEDAGKSVHGAQEGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHDLV
QWIGICDGNMQEGSFRCDVNVSVRPKGSEKLGTRREIKNLNSFKFMQQAIEYETSWQIET
LEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLAISESDISAVKADMPE
LPEAMKARFEAQFGLAHYDANALTSSRGTADYFVATVDAGSDAKLAANWVMGSVSAKLNA
EDKEISASPISPRALASLIKRIQDGTISNNAAKQVFEAMWTGEGDADSIIESKGLKQVSD
SGAIEAIVDEVLAANAAMVEEFKAGKEKAFNALVGQAMKASKGKANPAQVNEILKKKLEG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaagtcgtgatcgggctggaaactcacacccagctacaaaccaaaactaaa
atttttagtggtgcctccactgcgtttggttctgagccaaacacacaagcttgcgttgtg
agtttggcgtttcctggcgtcttgccagtgctcaatcaagaagcagtgaaatgcgcgatt
aaatttggcctcgcggtgaatgctgaaatcgcaccacgctctgtgtttgcacgtaagaat
tacttctatccagacttgcctaaaggctatcaaatcagccagtacgagctaccagtggtt
ggcaaaggcagcatgacgattcaagtgggtagcggcgacaaagcttatgaaaaagtcatc
aatattacccgtgcgcatttagaagaagatgctggtaaatctgtgcacggtgcacaagaa
ggcatgtctggcatcgacttaaaccgtgctggcacgccacttcttgaaattgtgactgaa
cctgatatgcgttcagctgctgaagcggtggcctatgctaaaaaattacatgatctagtg
caatggatcggcatttgcgatggcaacatgcaagaaggtagctttcgctgtgacgtgaac
gtttctgtgcgtcctaagggctcagaaaaacttggcactcgccgcgaaattaaaaactta
aactcattcaagtttatgcaacaggcgattgagtacgagacaagctggcaaattgaaacg
ttagaagatggcggcacgattcaacaagccaccgtgctatttaatccagacacaggcgaa
acgcgcgcgatgcgtagcaaagaagaagcgaacgattatcgctacttcccagaccctgat
ttgttaccgcttgcaatttcagaaagtgatatcagcgcagtcaaagctgacatgcctgaa
ttaccagaagcgatgaaagctcgctttgaagcacaatttggcttggcgcactatgatgca
aatgcgctcactagttcacgtggcacagcggattatttcgttgcgactgttgatgctggc
agcgatgcaaaactggcagctaactgggtcatgggtagtgtttcagccaagcttaatgct
gaagacaaagagatttcagcgtcaccaatttctcctagagctttagcaagcctcatcaaa
cgcattcaagacggcacaatttctaacaatgccgccaaacaagtgtttgaagcaatgtgg
actggcgaaggggatgcagacagcatcatcgaaagcaaaggcttaaaacaagtctctgat
agtggcgcaattgaagcgattgtggacgaagtacttgccgcaaatgctgccatggttgaa
gagtttaaagcaggtaaagaaaaggcgtttaacgcgcttgttggccaagcaatgaaagcc
tcaaaaggtaaagcgaaccctgcacaagtgaacgagattttgaagaagaaactagaaggc
taa

DBGET integrated database retrieval system