KEGG   Moraxellaceae bacterium HYN0046: HYN46_01030Help
Entry
HYN46_01030       CDS       T05575                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00473  D-Alanine metabolism
mbah00550  Peptidoglycan biosynthesis
mbah01100  Metabolic pathways
mbah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HYN46_01030
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HYN46_01030
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HYN46_01030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbah01011]
    HYN46_01030
Enzymes [BR:mbah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HYN46_01030
Peptidoglycan biosynthesis and degradation proteins [BR:mbah01011]
 Precursor biosynthesis
  Amino acid ligase
   HYN46_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AXI01603
UniProt: A0A345P2U4
LinkDB All DBs
Position
216479..217462
Genome map
AA seq 327 aa AA seqDB search
MGLKSMEQFGKVAVLFGGNSGEREVSLKSGQAVLDALLTKGVQAEAFDPSHRALSDLTDY
SRAFIVLHGRGGEDGQIQGLLEWMNIPYTGSGVLASALGMDKVRTKQLWKGIDLPTAPYR
LLDENTDFNAVVAELGLPLIVKPVHEGSSVGMSKVETLEQLEPAYQAASGHDAVVMAEAW
ITGREFTVAMLNGKALPVIRLQPPADVAFYDYQAKYIRNDTQYGIPSGLSDAEEKELQSL
ALRAFNAVGATGWGRVDAMQDEQGRFWLLEVNTVPGMTDHSLVPMAAKAIGYSFADLCVE
ILRQTLNQDGHVADATPASKPTAAHAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaaaaagcatggaacagtttggcaaagttgcggtgttgtttggtggaaattct
ggagaacgtgaagtctctttgaaaagtggtcaagccgttctcgatgcattattgacgaaa
ggtgtgcaggctgaagcatttgatccatcacatcgggcactcagcgacctcacggattat
tcccgtgcttttatcgtattgcatggtcgtggcggtgaagacggtcagatccaagggttg
ctggagtggatgaatatcccgtatacgggttcgggtgtgctggcctctgcattgggtatg
gacaaagttcgtaccaaacagctgtggaaagggattgatcttccgactgcgccataccgt
ttgttggatgaaaatactgattttaatgcggtggttgccgagctcggcctaccgctgatt
gttaaaccggttcatgaaggctcaagcgtgggcatgagcaaagtggagacactggagcaa
ctggagcccgcctatcaggcggcaagcggtcatgatgcggtggtaatggcggaagcgtgg
attacgggccgtgaatttaccgttgcgatgctgaatggcaaagcactgccagtgattcgt
ttgcaaccacctgcagatgttgctttttatgattatcaagccaaatacatccgtaatgac
acgcaatacggaattccctccggtttaagcgatgcagaagaaaaagaactgcaatcactg
gcgttacgggcttttaatgccgtgggtgcgactggctggggtcgtgtcgatgccatgcaa
gatgagcaaggtcgtttttggctactggaagtcaatacagtgccgggtatgaccgatcac
tctctggtgccaatggccgcaaaagcaatagggtattcctttgctgatctgtgtgtagag
attttgcgtcagacgttgaatcaggatggacacgttgcagatgctacgccagcttccaag
cctactgctgcacatgcgggttga

DBGET integrated database retrieval system