KEGG   Moraxellaceae bacterium HYN0046: HYN46_04325Help
Entry
HYN46_04325       CDS       T05575                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00020  Citrate cycle (TCA cycle)
mbah00190  Oxidative phosphorylation
mbah00650  Butanoate metabolism
mbah01100  Metabolic pathways
mbah01110  Biosynthesis of secondary metabolites
mbah01120  Microbial metabolism in diverse environments
mbah01130  Biosynthesis of antibiotics
mbah01200  Carbon metabolism
Module
mbah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HYN46_04325
   00650 Butanoate metabolism
    HYN46_04325
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HYN46_04325
Enzymes [BR:mbah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HYN46_04325
    1.3.5.4  fumarate reductase (quinol)
     HYN46_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AXI02146
UniProt: A0A345P4D7
LinkDB All DBs
Position
977442..979265
Genome map
AA seq 607 aa AA seqDB search
MAALSKDDMSNIKTLNFDAVIVGGGGSGMRASLQLARAGLKVAVLTKVFPTRSHTVAAQG
GIGASLGNMDEDNWHYHFYDTVKGGDWLGDEDAIEFMTREAPKMVYELEHMGMPFDRNAD
GTIYQRPFGGHSSNYGEKAVPRACAAADRTGHALLHTLYQKNLEMGTQFFVEWIALDLIR
DDDGEVLGVTAIDQETGTVGVFQAKATLFATGGAGRIYAASTNAYINTGDGLGMAARAGI
PLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAVLRNKNGEPFMERYAPTLKDLAPRDFVSR
SMDQEIKEGRGCGPRGDYVLLDMTHLGKERIMKRLPSVFEIGKKFANVDCTKEPIPVVPT
IHYQMGGIPTNIHGQVVVPKDGEPNVVVKGLYAIGECSCVSVHGANRLGTNSLLDLIVFG
KAAGDHITETVRNSSSDYKPLPSHVLQRSMGRINKLQESTQGENAQDVADAIRAVMQTHA
GVFRTQALMDEGVQQIMALEPRVKNIHLADKSQVFNTARIEALEVENLFEVAKATIVSAA
ARKECRGAHTVVDYEYPADHPTMANGRNDEEWRKHTLWYSVDNRLEYKPVRTKPLTVDPV
PPKPRTF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcattgtccaaagatgacatgagcaatatcaagaccctgaacttcgacgccgtg
attgttggtggcggcggttcaggtatgcgtgcttcattacagcttgcacgcgcaggtctt
aaagttgcggttttaacgaaagtatttccaacccgttcgcatactgttgccgctcaaggc
ggtattggtgcgagtctggggaatatggatgaagataattggcactaccacttttacgat
accgtaaaaggtggagactggctcggtgatgaagacgcgattgagttcatgacccgtgaa
gcaccaaaaatggtgtacgagcttgagcacatgggtatgccgtttgaccgtaacgcagat
ggaacaatctatcaacgtccattcggtggtcatagttctaactatggtgagaaagcggtg
ccgcgtgcatgtgcggcagctgaccgtacagggcatgcactcttgcatacgctctatcaa
aagaatcttgaaatggggacgcaattcttcgttgaatggattgcacttgatttgattcgt
gatgatgatggcgaagtgttgggtgtaacagcgatcgatcaagaaactggtaccgtaggt
gtattccaagccaaagcaaccttgtttgcaacgggtggtgcaggtcgtatctatgccgcg
tcaaccaatgcatacatcaacacgggtgatggcttgggtatggctgcacgagctggcatt
ccattacaagatatggagttctggcaattccacccaacgggtgtggcgggtgctggtgtg
ctcttgactgagggttgtcgtggtgaaggtgcggttcttcgtaacaaaaacggcgagccg
ttcatggagcgttatgcaccgacactaaaagacttagccccacgtgatttcgtatcgcgt
tcgatggaccaagagattaaagaaggacgcgggtgtggtcctcgcggtgattatgtgttg
ctcgatatgacccatttgggtaaagagcgcatcatgaagcgtctgccatcagttttcgaa
atcggtaagaagtttgccaacgttgactgtaccaaagagccaattccagtcgtgccaaca
atccattatcaaatgggtggtattccaacgaacattcatggtcaagtggttgtacctaaa
gacggcgagccaaacgtggtcgtcaaaggcctgtatgcgatcggtgaatgttcatgtgtg
agtgtgcacggtgcaaaccgtctgggcaccaactcactccttgacttgatcgtatttggt
aaagcggctggtgatcatatcactgagactgtgcgtaactcgtcaagcgattacaagcca
ctaccttcacatgtactgcaacgcagcatgggccgtattaacaagttgcaagagtctaca
caaggtgaaaatgcacaagacgtcgcggatgcaatccgtgcagttatgcagactcatgct
ggcgtgttccgtactcaagcactgatggatgagggtgtgcagcagattatggcgctggaa
ccacgtgttaaaaatatccatttggcagataagtcacaagtcttcaatacggcacgtatc
gaagcactagaggttgagaacttgtttgaggtggctaaagcaaccatcgtttctgctgct
gcacgtaaagagtgtcgcggtgcgcacactgttgtagattacgaatatcctgcggatcat
cctactatggccaatggtcgtaacgatgaagagtggcgtaaacacacgctgtggtactct
gtcgacaaccgtttggaatacaagcctgtacgcacgaagccgttgactgttgatccagtc
ccacctaagccacgtacgttctaa

DBGET integrated database retrieval system