KEGG   Moraxellaceae bacterium HYN0046: HYN46_04330Help
Entry
HYN46_04330       CDS       T05575                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00020  Citrate cycle (TCA cycle)
mbah00190  Oxidative phosphorylation
mbah00650  Butanoate metabolism
mbah01100  Metabolic pathways
mbah01110  Biosynthesis of secondary metabolites
mbah01120  Microbial metabolism in diverse environments
mbah01130  Biosynthesis of antibiotics
mbah01200  Carbon metabolism
Module
mbah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HYN46_04330
   00650 Butanoate metabolism
    HYN46_04330
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HYN46_04330
Enzymes [BR:mbah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HYN46_04330
    1.3.5.4  fumarate reductase (quinol)
     HYN46_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_9 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AXI02147
UniProt: A0A345P4D8
LinkDB All DBs
Position
979282..979992
Genome map
AA seq 236 aa AA seqDB search
MSHGIRTFEIYRYDPDKDKAPYMQTFQIQLEESDRMLLDALIKLKKQDETLSFRRSCREG
ICGSDGMNINGKNGLACLQNLNDLPAKIVLRPLPGLPVIRDLVVDMTQFYTQYEKVRPYL
INEQPAPPTERLQSPEDREKLDGLYECILCACCSTSCPSFWWNPDKFLGPSALLQAYRFI
ADTRDKDTAKRLADLDDPFSLFRCRGIMNCVSVCPKGLNPTKAIGHIRNMILDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacggaatccgtacttttgaaatctatcgctatgatcctgataaggataaagcg
ccttacatgcagacttttcagattcagttggaagaaagcgaccgtatgttgctggatgcg
ctgatcaaactgaagaagcaagatgaaactttgtcgttccgccgttcatgccgtgaaggc
atttgtggttctgatggcatgaatatcaatggcaaaaatggtttggcgtgcttgcagaac
ttaaatgatttgcctgctaaaatcgtattacgccctttgccaggcttgccagtgattcgt
gatctggttgtggatatgacccaattttatactcagtatgaaaaagttcgtccatatctt
atcaatgaacaaccagcaccgccaactgagcgcctgcaatctcctgaagaccgtgaaaag
ttggatggtttgtatgagtgcattctgtgtgcatgttgctccacatcatgtccatcattc
tggtggaatcctgataagttcttgggtccatctgcattacttcaagcgtatcgttttatc
gcggatacacgtgataaagatactgctaaacgtttagctgatctggatgatccattcagc
ttattccgttgccgtggaattatgaactgtgtgtcagtttgtccaaaagggttgaatcca
accaaagcaattggtcatatccgtaatatgatcttagatcaagcgggttaa

DBGET integrated database retrieval system