KEGG   Moraxellaceae bacterium HYN0046: HYN46_06685Help
Entry
HYN46_06685       CDS       T05575                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00564  Glycerophospholipid metabolism
mbah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HYN46_06685
Enzymes [BR:mbah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HYN46_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 HI0933_like Lycopene_cycl 3HCDH_N GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AXI02539
UniProt: A0A345P5I0
LinkDB All DBs
Position
1496964..1498595
Genome map
AA seq 543 aa AA seqDB search
MTNDSLAAEPDLNDSIYDLVVIGGGINGVGIARDAAGRGLRVLLVEKGDFAGATSSASSK
LIHGGLRYLEYYEFRLVREALAERERLLAIAPHIAWPMSFVMPHIAGLRPRWMIRTGLFL
YDRLGGRISLAKSKAVTLTNTLLGKPLKALFSQGFTYSDAWVDDARLVVLNALSAQQHGA
QLLPRVSFEQAKRVGHFWHIEVKPTEIHPSPEQIPTHIRARMLVNASGPWVESVRARIEL
NDSILDEGILESNIKTQKQAGLGQLRLVQGSHMVVAQCYEGNHAYILQHTDRRVIFMLPY
EHDYTLIGTTDLPLTDPNQQPTMTDAEVEYLCDAVNQYLEHPVKPQDVIWRYSGVRPLMD
QGDTDNPSAVSRDYELKIEALNEVVPLLTVLGGKLTTYRKLAEHALDDLSDFCIDLPKGW
TDQEVLPGGDIPDGWHGFEAWQTQFIAQYPDLDSEWLASITRRYGTLIPQVLSSLKSQSA
PFGVSDLGLHFGGGLYECEVRYLRQNEWAWQAEDILWRRTKCGLHMTVDERISFEKWFKQ
HNL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgatagcttggcagcagaacctgatttgaatgattcaatctacgatttggtc
gttattggaggtggtattaatggcgtgggaatagcacgcgatgcagcaggtcgtggttta
cgtgtattgttggttgaaaaaggggattttgctggagcgacatcgagtgcatccagtaag
cttattcatggtggtttacgttaccttgaatattatgagttccgtttagttcgcgaagcc
ttggctgaacgtgagcgactccttgccattgcccctcatatcgcatggccgatgagtttt
gttatgccgcatatcgcaggtttacgtccgcgttggatgatccgtacagggctttttttg
tatgatcgattgggtggtcgcatttccttggcaaaatctaaagcggtcaccttgacgaat
acccttttgggaaagccgcttaaagccttattcagtcaagggttcacatattcagatgca
tgggttgatgacgcgcgacttgttgtattaaacgcgctatctgcgcagcagcatggtgcg
caattgttgccgcgagtgagttttgagcaagccaagcgggtaggtcatttttggcatatc
gaggttaagccgacagaaattcatccatcaccagaacagatacccacccatatccgagct
cgaatgctggtcaacgccagtggtccgtgggtagaaagcgtgagagctcgtattgagctg
aatgattctattcttgatgaagggattcttgaatcgaacatcaagactcaaaagcaggcg
gggcttggccaattacgattagtacaaggttcgcatatggttgttgcacaatgttatgaa
ggaaatcatgcttatatccttcagcatactgatcgacgagttatttttatgctgccctat
gagcatgattataccttgatcggaacgactgatttaccgcttactgatccaaatcaacag
ccaacaatgacggatgctgaagttgaatatctgtgtgatgcagttaatcaatatctagag
caccctgtcaaaccacaagatgtcatctggcgctatagtggcgtgcgtccactcatggat
caaggggatacggataatccatccgcagtttctcgtgattatgaacttaaaatcgaggca
ttaaatgaggtagtgccgttactgacggtgttaggcgggaaactgacaacctatcgtaaa
ctcgcagaacatgcgctggatgacttatctgacttctgtatagatttgcctaaaggttgg
acagatcaggaagtcttacctggtggggatattcctgatggttggcatggttttgaggct
tggcagactcaatttatcgcgcagtatccagatctcgattcggagtggcttgccagtata
actcggcggtatggtacgttgatacctcaagttctcagtagccttaaatcacagtcagcg
ccctttggtgtaagtgatttaggcttgcactttggtggtggcttatatgaatgtgaagtt
cgttatttaagacaaaacgaatgggcttggcaagcagaagatattctttggcgtagaacg
aaatgcggtttacacatgaccgttgatgagcgcatttcctttgaaaaatggtttaagcaa
cacaatctttaa

DBGET integrated database retrieval system