KEGG   Moraxellaceae bacterium HYN0046: HYN46_08670Help
Entry
HYN46_08670       CDS       T05575                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00071  Fatty acid degradation
mbah00280  Valine, leucine and isoleucine degradation
mbah00281  Geraniol degradation
mbah00310  Lysine degradation
mbah00362  Benzoate degradation
mbah00380  Tryptophan metabolism
mbah00410  beta-Alanine metabolism
mbah00640  Propanoate metabolism
mbah00650  Butanoate metabolism
mbah00903  Limonene and pinene degradation
mbah00930  Caprolactam degradation
mbah01100  Metabolic pathways
mbah01110  Biosynthesis of secondary metabolites
mbah01120  Microbial metabolism in diverse environments
mbah01130  Biosynthesis of antibiotics
mbah01200  Carbon metabolism
mbah01212  Fatty acid metabolism
Module
mbah_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HYN46_08670
   00650 Butanoate metabolism
    HYN46_08670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYN46_08670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYN46_08670
   00310 Lysine degradation
    HYN46_08670
   00380 Tryptophan metabolism
    HYN46_08670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HYN46_08670
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HYN46_08670
   00281 Geraniol degradation
    HYN46_08670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYN46_08670
   00930 Caprolactam degradation
    HYN46_08670
Enzymes [BR:mbah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HYN46_08670
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HYN46_08670
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HYN46_08670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C DUF2680
Motif
Other DBs
NCBI-ProteinID: AXI02904
UniProt: A0A345P6J5
LinkDB All DBs
Position
1936817..1938955
Genome map
AA seq 712 aa AA seqDB search
MSAIKYNKDQDNIVTLTLDSTGQSANTMNAEFRVSLHEVATKLKAETDLAGVIITSAKKT
FFAGGDLDELILVKRSDATEFFKMIESLKADMRAIETLGKPVVAALNGTALGGGWEIALA
THHRIALNDPKTKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFDVKKAVSL
GLVHDTGETIDEVLAKAHAWIKANPKSQQPFDVKGYKIPGGDPRTPAVAQILAIAPAMLR
DKTKGCYPAPEAIMSAAAEGASVDVDTALRIESRYFAQITTGQVAKNMIGTFWFQLNAIK
AGHSRPDGIAPWKATKVGVLGAGMMGSGIAYATAIKGVPVVLKDVSAEAAEKGKSYSQKL
LEKRVSRGSLTADKKDAILANITATADAKDLAGCDLIIEAVFENRELKAKVTQEAEAQLV
AGGIMASNTSTLPITGLSQASKDATHYIGLHFFSPVDKMQLVEIIKGKDTSPETLARAFD
YVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMSLVAEGIHPARVEMAALKAGMPVGPLAI
QDEVSLSLTEHITEQTRKDLQAEGKDLPVQATEALVKAMIHDHNRKGKAAGAGFYEYPVG
GKKHLWSGLSTWLKPEVTISEQEMIDRILFVQALDTIRCLEEGVLESVQDANIGSIFGIG
FAPWTGGAIQFINQYGLDKAVKRAEELTAKYGQRFTPPQLLKDKAAKGELFV
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaattaagtacaataaagaccaagataacatcgtcacactgactctagattct
acaggtcaatccgcaaacaccatgaatgctgagtttcgcgtcagcctgcatgaagtcgct
acaaaactcaaagctgaaactgacctcgctggtgtcatcattacttctgcgaaaaaaacc
ttttttgctggcggtgacttggatgaactcattctggttaaacgttcagatgcgactgaa
ttctttaagatgatcgaatcgcttaaagcggatatgcgtgctattgagactttgggcaaa
cctgtagttgcggcactcaacggcacagcactcggcggtggctgggaaatagctttggca
acccatcatcgtatcgccctgaatgatcctaaaaccaaatttggtttacctgaagttact
ttgggcttactgcctggtggtggtggtatcgtacgtatggtgcgcttgctcggcctgcaa
aatgctttcccattcttaatggaaggcaaacagtttgatgtgaaaaaagcagtgtctctc
ggactggttcacgatactggcgaaaccatagacgaagttttggcaaaagcacatgcgtgg
atcaaagcaaatccaaaatcacaacaaccctttgatgtgaaaggctataaaattccaggt
ggtgatccgcgcacaccagcagtcgctcaaatactggcaatcgctccagcaatgctgcgt
gacaaaaccaaaggttgctaccctgcacctgaagcgatcatgagtgcagctgcggaaggt
gcttccgtggatgtcgataccgctcttcgtatcgaatctcgttacttcgctcaaatcaca
acaggtcaagttgccaaaaacatgattggtaccttctggttccaattgaatgccattaaa
gccggtcatagccgtcctgatggcattgcgccatggaaagcaaccaaagtgggcgtactg
ggtgcaggcatgatgggtagcggtatcgcttacgcgacagccatcaaaggcgtgcctgtc
gtactcaaagatgtttcagcggaagctgcggaaaaaggtaaaagctacagtcaaaaacta
cttgaaaaacgtgtttctcgcggcagtttaaccgctgacaagaaagatgcgattttagct
aatatcaccgcaactgctgatgccaaagatttggcaggttgtgacctaatcattgaagcc
gtatttgaaaatcgtgaattgaaagctaaagtgacccaagaggctgaggcacaattggtt
gctggcggtatcatggcatccaatacatcaactttgcccatcacgggtttatcgcaagcc
agcaaagacgcaacccactatatcggcctccacttctttagcccagtcgacaaaatgcaa
ctggttgaaatcataaaaggtaaagataccagtcccgagactctggcacgtgcatttgat
tatgttcaacaaattggcaaaacaccgattgtggtcaatgatagtcgtggattcttcact
agccgtgtatttggtaccttcattcaagagggcatgtcattggttgctgaaggcatccac
cctgcacgtgttgaaatggcggcattaaaagcaggtatgcctgttggtccattggccatt
caagatgaagttagtcttagtctgactgaacacatcaccgagcaaacacgtaaagaccta
caagcagaaggtaaagatctgcctgtacaagcgactgaggcactggtcaaagccatgatc
cacgatcacaaccgtaaaggaaaagctgcaggcgcaggtttctatgaataccctgttggc
ggcaaaaaacacttatggtcgggtctatcaacgtggctgaaaccggaagtcactatcagt
gaacaggaaatgattgatcgcatcctgtttgttcaagccttggatacgatccgctgcttg
gaagaaggtgtacttgagtctgttcaagatgccaatatcggttctattttcggtatcggt
tttgcaccatggacaggtggtgcgattcagttcatcaaccagtatggtttggacaaggcg
gttaagcgcgctgaagagctaacagcaaaatacggccaacgctttaccccaccgcaatta
ttaaaagataaagcggcgaaaggtgaattgtttgtctaa

DBGET integrated database retrieval system