KEGG   Moraxellaceae bacterium HYN0046: HYN46_09715Help
Entry
HYN46_09715       CDS       T05575                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00970  Aminoacyl-tRNA biosynthesis
mbah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN46_09715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mbah03029]
    HYN46_09715
Enzymes [BR:mbah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYN46_09715
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYN46_09715
Mitochondrial biogenesis [BR:mbah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYN46_09715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXI03093
UniProt: A0A345P734
LinkDB All DBs
Position
2155651..2157174
Genome map
AA seq 507 aa AA seqDB search
MTELHRLDIRELAQGLASKQFSSLELTQHFLARIDRLDAKLNSFITVTHESALANARSAD
ALRAQGNAGVLTGIPIAHKDIFCTEGVKTSAGSKMLDNFISPYNATVVAQANAAGLVMLG
KTNMDEFAMGSSNESSFYGATHNPWALNRVPGGSSGGSAAAVAADLAPFATATDTGGSIR
QPAAFCGLTGLKPTYGRVSRFGMIAYASSLDQGGPIARSAEDCAYLLQVMAGHDAKDSTS
VDHPTEDYVAGITTTTNPDKPLQGLRIGLPHQYIKDGLDADVKARVLDALKVLEDLGATL
VEINLTTSDAAIPAYYLIAPSEASSNLSRYDGVRFGHRCENPKDLMDLYTRSRTEGFGDE
VQRRILIGTYALSEGYYDAYYLKAQKVRRLIQNDFLKAFEQCDVIAGPTAPTAAYAIGAK
QDPVAMYLGDIYTIAVNLAGLPAISAPVGFDTSYSGHDNCAPLPVGLQLIGPYWSESKLL
SIIHQYQQRTDWHKQRAPIASDAGAAL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattacatcgattagatatccgcgagcttgcacaaggactcgctagcaaacag
ttctcatcacttgagctgacccagcattttttagcgcgtattgatcgcctagatgccaag
ctgaacagctttatcaccgtaacacatgagtctgcactcgccaatgcacgcagtgcagat
gcattacgtgctcagggcaatgcaggcgtgttaacgggcattcctattgctcacaaagat
attttttgtactgaaggggtaaaaacctctgcgggctcaaaaatgctggataatttcatc
tccccttataacgccactgtagtggcacaagccaatgcggcaggtctcgtcatgttgggc
aaaaccaatatggatgagttcgcgatgggctccagtaatgaaagctctttttacggtgca
acacacaacccctgggccttaaatcgcgtaccgggtggctcttcaggtggatcagcagca
gccgttgcagccgaccttgccccctttgcaaccgcaaccgatacaggtggctcaattcgc
cagcctgcggcattctgcggtctcacagggcttaaacccacctatggccgtgtctcccga
tttggcatgattgcgtatgcctctagcctagatcagggtggtcccattgctcgaagtgca
gaagattgtgcctatttacttcaagtgatggcagggcatgatgccaaagattcgaccagc
gtagatcaccccactgaagattatgtggcgggtatcactacaaccaccaaccctgacaaa
ccgctccaaggtttacgcatcggcttaccgcatcaatacatcaaagatggcctagatgca
gatgtcaaagcacgcgtgctcgatgcgctcaaagtcttagaggatttaggcgcaacactg
gtggagatcaatctcaccacctccgatgctgcgattccagcctattacttaattgcaccc
tctgaagcatccagcaacttgtcgcgttatgacggcgtgcgttttggacatcgctgtgag
aacccgaaagacttgatggatctatatacacgctcacgcacagaaggttttggcgatgaa
gtgcagcgccggattttaatcggcacctatgcgttatcagagggttactatgatgcttac
tatctcaaagcacaaaaagtgcgtcgtttaattcaaaatgacttcctcaaagcatttgaa
caatgtgatgtcatcgcaggacccaccgcgcctaccgcagcctatgccatcggtgccaaa
caagatccggttgcgatgtacttaggcgacatttacaccatcgcagtcaaccttgcgggt
ttacctgcgatcagtgcgcctgttggatttgataccagctatagcggccatgacaactgc
gctcccctgcctgtgggactgcaattgatcgggccatactggtctgaaagcaaattactg
tcgatcattcatcaatatcaacaacgtaccgattggcataaacaacgtgcgccaatagca
agtgatgcaggagcagccctatga

DBGET integrated database retrieval system