KEGG   Moraxellaceae bacterium HYN0046: HYN46_09720Help
Entry
HYN46_09720       CDS       T05575                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00970  Aminoacyl-tRNA biosynthesis
mbah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN46_09720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mbah03029]
    HYN46_09720
Enzymes [BR:mbah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYN46_09720
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYN46_09720
Mitochondrial biogenesis [BR:mbah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYN46_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Rhomboid_SP Rep_fac_C
Motif
Other DBs
NCBI-ProteinID: AXI03094
UniProt: A0A345P735
LinkDB All DBs
Position
2157171..2158631
Genome map
AA seq 486 aa AA seqDB search
MSLLVQGWEVVIGLEIHCQLNTQSKIFSGSPTAFGAEPNTQASLIDLALPGTLPVLNREV
VNKAVRFGLGIDAEIGRASVFARKNYFYPDLPKGYQISQMDDPIVGKGHVDIVLEDGTVK
RVGVTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVSEPDMRSSAEAVAYVKTIHA
LVRWLGISDGNMAEGSFRCDCNVSIRKPGAPEYGTRCELKNINSFRFIERAIEAEVDRQI
DLIESGGKVKQQTRLYDPNKNETRAMRSKEEANDYRYFPDPDLLPVVISEAQIEQIRSEL
PELPEARKSRFVSEYQLSDYDARILNGARELADFYEDAVKASGNISQAKIVANWVMGDLL
GALNKAEKELADSPVTPAQLGGLVARIADNTISGKIAKVVFIDMMQGNGESADDIIAAKG
LKQETDTGAIEAIIKEVLAANEKMVEEYRAGKEKAFNGLVGQIMKASKGKANPSQVNSLL
LEMLKN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtctattagtccaaggctgggaagtcgtcattggtttagagatccattgtcagcta
aacacacaaagtaagattttctcgggttcgccaactgcattcggtgcagagcccaacacc
caagccagtttgattgaccttgccctaccaggcacactgccagtgctaaaccgtgaagtg
gtcaataaagccgtacgctttggtctcggtatcgatgcggagattggacgagcatcggta
tttgcacgtaaaaactacttctaccctgaccttcctaagggctatcaaatcagccagatg
gatgatcctatcgtcggcaaaggtcatgtcgatatcgtgctggaagatggcacagtcaag
cgtgtcggtgtgacccgcgctcacttagaggaagatgccggtaaatcattacacgaagac
ttcgcaggcatgacgggtattgaccttaatcgtgcgggaacgcccctgcttgaaatcgtc
agcgaacctgatatgcgctctagtgcagaagcggttgcctatgtgaagaccatacacgcg
ctggtacgctggcttgggatcagtgatggcaatatggccgaaggctctttccgctgtgat
tgtaacgtctcaatccgcaaacctggtgcgcccgaatacggcacacgctgtgagttaaaa
aacattaactcatttcgttttattgaacgtgcaattgaagccgaagttgaccgtcaaatc
gatttgatcgaaagcggtgggaaagtcaaacaacaaacccgcttgtatgatccaaacaaa
aacgagacgcgtgcgatgcgcagcaaagaagaagcgaacgactatcgctacttcccagat
ccggatttactgccagtcgtcatcagcgaagcacaaattgaacagattcgtagcgagctc
ccagagctgccagaagctcgtaaatcacgttttgtctctgaatatcagctcagtgattat
gatgcacgcattctgaatggtgcacgagaactcgctgatttctatgaagatgccgtcaaa
gcgtcaggcaacatcagccaagcgaaaatcgttgccaactgggtcatgggcgacttgctt
ggcgcactcaacaaggccgagaaagaactggcagattctcctgtgactcctgctcaattg
ggcggtttggttgcgcgtattgccgataacaccatcagtggcaagattgcaaaagtggtc
tttatcgacatgatgcaaggcaatggtgaatcagcagatgacatcatcgcagccaaaggg
ttgaaacaagaaaccgataccggtgccattgaagccatcattaaagaagttttggctgcc
aatgaaaaaatggtggaagaatatcgtgcaggcaaagagaaagcgttcaatggtttggtc
ggccaaatcatgaaagcgtctaaaggcaaagcgaacccaagccaagtcaattcacttttg
cttgaaatgctgaagaactaa

DBGET integrated database retrieval system