KEGG   Methanosarcina barkeri 3: MSBR3_2274
Entry
MSBR3_2274        CDS       T04533                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00300  Lysine biosynthesis
mbak01100  Metabolic pathways
mbak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSBR3_2274
Enzymes [BR:mbak01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSBR3_2274
SSDB
Motif
Pfam: NAD_binding_7 NAD_binding_2 3HCDH_N Mur_ligase UDPG_MGDP_dh_N 2-Hacid_dh_C Shikimate_DH
Other DBs
NCBI-ProteinID: AKB82852
UniProt: A0A0E3SMW4
LinkDB
Position
complement(3025010..3025789)
AA seq 259 aa
MALLTPNDLININKQLQEADSTVQRVTGLDIKGICKALYGTFPGSEKVGIVPVTSGNGII
GNFSASLNAITQYFGFESFVTDMLDVSGYYEAVRNGAEIILMADDYTFLAHNLKNGKMAN
NQPCTGIIYAEIASRYLKADSKNVLVVGLGKVGFPGAAHLVQKGFRVYGYDPDENFLQRA
VSSLGVIPFNPEKPKKFSIIFEATPCANTIPEPVLSENCVLSTPGIPCAISEELRTKYDV
QLVAEPLGIGTVSMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaactccaaacgatttgataaatattaataaacagcttcaggaagccgat
tctactgttcaaagagtaacagggcttgacataaaaggcatctgtaaagctctctacggt
actttccctggttccgaaaaagtaggtattgttcccgtaacttcgggaaatgggataata
ggaaacttttccgcttccctgaacgcgattactcagtatttcggatttgaaagttttgtt
acggatatgctggatgttagcggctattatgaagctgtacggaacggagctgagattatt
ctcatggccgacgactacacttttcttgcgcataacctcaaaaacggaaaaatggccaat
aaccaaccctgcacaggtataatttatgctgagattgcttccagatacctgaaagccgat
tcaaagaacgtacttgttgtgggactcggaaaggtaggttttcccggagcagcccacctt
gtgcagaaaggcttcagggtttacggttatgatcctgatgaaaacttccttcagagagcc
gtttcaagcctcggggttatcccgttcaaccctgaaaaaccaaaaaagttttccattatt
ttcgaagcgactccgtgcgcaaacacgattcctgaacctgtactttcggagaactgcgtg
ctttcaactccaggaattccctgtgcaatctctgaagaacttcgaacaaaatatgatgta
caacttgtagctgaacctcttggaatcggaacggtatcaatgctgtattctgtgctctaa

DBGET integrated database retrieval system