KEGG   Methanosarcina barkeri 3: MSBR3_2349Help
Entry
MSBR3_2349        CDS       T04533                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00630  Glyoxylate and dicarboxylate metabolism
mbak01100  Metabolic pathways
mbak01120  Microbial metabolism in diverse environments
mbak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSBR3_2349
Enzymes [BR:mbak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSBR3_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB82927
UniProt: A0A0E3SN11
LinkDB All DBs
Position
complement(3110957..3112243)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDTGYSPKDTDLICEFHIEPSAGVNFEEAATHMAGESSIDSWTEISTLSPELAAR
LKPHVFYVNEDAQTVRVAYSEELFELGSVPQVLSAVAGNILSMKVVDNLRLQDIAFPGSM
LHEFKGPKFGLPGIRELTGVQDRPLIGTIVKPKVGLTSEKHAEVAYKSFAGGCDLVKDDE
NLTDQKFNGFEKRAELTLKLAEKAESETGERKMYLCNITAPTCKEMIRRMNILKDLGASY
AMIDIVPAGWTALQTLREEADDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDNVPADENQHILAQNWGRLKPMFPVASGGLAPT
MIPDLYTIFGKDVIMQFGGGIHAHPMGTAAGATACRQALEATLEGVSLQEYAKSHRELEV
AIDKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagggattatatagacacgggctacagcccaaaggataccgatcttatatgtgag
ttccacatcgaaccgtcagcaggagtgaattttgaggaagctgcaactcatatggcaggt
gaaagctctatagactcctggactgaaatttcaacgctaagtcccgaacttgcagccagg
ttaaagccccatgtcttttacgtgaatgaagatgcgcagactgtaagggtagcttattcg
gaagagctctttgaactcgggtcggtcccgcaggtactcagtgcggtcgcgggaaatatc
ctgagtatgaaagtagttgacaatcttaggctgcaggatattgctttccctggttcgatg
cttcatgaatttaaaggacctaagttcggattgccaggaataagggaacttacaggagtt
caggacaggcctctcataggaactattgtcaagccgaaagttggattaacctccgaaaaa
cacgctgaggttgcttacaaatcctttgcaggaggttgcgaccttgtgaaagacgatgag
aaccttacggatcagaagtttaatggctttgaaaaaagagctgaacttacactgaagctt
gcagaaaaggcagaatctgagacaggagagcgtaaaatgtatctctgcaacattactgcc
cctacctgtaaggaaatgatccgccgcatgaatatccttaaagacctgggtgccagctat
gcgatgattgacatcgtacctgcaggctggactgcgcttcagaccctgagggaagaagca
gacgatgcgggacttgctctccatgctcaccgatgcatgcattcagcctatactcggaat
ccacgccacggtataagcatgcttgtggttgccaagctctgcaggttgatcgggcttgac
cagcttcacataggtacggttgtaggaaaaatgcacggagaaaaacacgaggttctatct
cttcgtgacgaatgtgtgctagacaatgtgcctgcggatgaaaaccagcatattcttgcc
cagaactggggaagattgaaacccatgttccctgttgcatctggagggcttgctcctact
atgattcctgacctgtacaccatcttcgggaaggatgttattatgcagtttggtggcgga
attcacgcccatccaatgggcacggcagccggggccactgcttgcaggcaggcacttgaa
gcaactcttgaaggagttagcctgcaagaatatgcgaaaagccacagagaacttgaggtt
gccatcgataaatggctgaaaaaataa

DBGET integrated database retrieval system