KEGG   Methanosarcina barkeri 227: MSBR2_1172Help
Entry
MSBR2_1172        CDS       T03914                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mbar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSBR2_1172
Enzymes [BR:mbar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MSBR2_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AKB57688
UniProt: A0A0E3R2K0
LinkDB All DBs
Position
1494193..1495674
Genome map
AA seq 493 aa AA seqDB search
MVQDYKLFIGGEFKASSTGETFEDLNPATLESLATIQVAGPEDVDRAVEAAEAGFRLWNE
VPAAKRAEVLFRAARILQERKEELAVLMTEEMGKVLPETRGDVQEAIDITNYAAGEGRRM
LGETTTSELKEKFCMTVLRPIGVVGLITPWNFPIAIPAWKIMPALVAGNAIVFKPASDTP
LLAFKLIEVLSEAGLPPGVINLVTGPGGTVGKAVVRHPHIKAISFTGSLDTGKWIMEECS
KTMKRVSLELGGKNPVIVMDDADLELALEGVLWGAFGTTGQRCTATSRLILHEKIKDEFI
KRLLAKAKALRIGEGLLPETDIGPVINKAQLEKIEKYVKIGKEEGATLLYGGNRIDLGLP
GYFFEPTIFTDVRPDMRIAQEEIFGPVLGVFTVSDLEEAITLANSTRYGLSSAIYTENIG
NAFRAIEKIEAGITYVNAPTIGAEVHLPFGGVKGTGNGFREAGTEAVKEFSEVKAVYIDY
SGRLQKAQIDSAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggattacaagctgtttatagggggagaatttaaggcctcttcaaccggagag
acttttgaagatctaaatccggctactctagaaagcctggcaacaatacaggtcgctgga
cctgaggacgtggacagggcagttgaggctgctgaagcaggattcaggctctggaacgag
gtcccggctgcaaaaagagctgaagtactcttcagggcagcccggattttacaggaaagg
aaggaagaacttgccgtccttatgacagaagagatgggaaaggtgctgcctgagacaagg
ggagatgtacaggaagccattgatatcacaaattatgccgccggggaaggaaggcggatg
cttggggagacaacgacttccgaactcaaggaaaagttctgcatgaccgtactcaggccg
ataggggtagttggcttaataactccctggaactttccgattgctattcccgcgtggaag
attatgccagcccttgtagctggaaacgcgattgtttttaagcccgcaagtgacacgcct
ctgcttgccttcaagctgatagaggtgcttagtgaagcaggcttgcctcccggagtgata
aatctagtaacagggcccggaggaactgttgggaaagctgtagtccggcaccctcacata
aaggctatctcctttacaggcagccttgataccggaaaatggatcatggaagagtgttca
aaaaccatgaaaagagtctctttggaactcggaggcaaaaacccggtaattgttatggat
gatgccgaccttgaactggcccttgaaggtgtgctgtggggagcttttgggactacagga
cagcgctgtactgctacgagcaggctgattctgcatgagaagataaaggatgaattcata
aaaaggctgcttgcaaaagcaaaagctcttagaataggtgaaggactcctgcctgagacg
gatataggacctgtaatcaacaaagctcagcttgagaagatcgaaaaatacgtgaaaata
ggaaaagaagaaggagcaactcttctttacgggggaaacagaattgatctcgggcttcct
ggctatttcttcgagcccacaatatttacggatgtcaggccagacatgcgaattgcacag
gaagagattttcgggccagtactcggggtctttacggtttcagaccttgaagaggcgatc
acacttgcgaatagtaccagatacgggctttcttcggcaatctacactgagaatatagga
aacgctttcagggcaatcgaaaaaatcgaagccggaatcacatatgttaatgctcctaca
ataggagccgaagtccatctcccctttggaggggtcaaagggacaggaaatggttttcgg
gaagctggtaccgaggctgtcaaggagttttccgaggtaaaagctgtgtatatagactac
agcggcaggctgcaaaaagctcagatagattcagcggaataa

DBGET integrated database retrieval system