KEGG   Methanosarcina barkeri 227: MSBR2_1391Help
Entry
MSBR2_1391        CDS       T03914                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar03030  DNA replication
mbar03410  Base excision repair
mbar03420  Nucleotide excision repair
mbar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mbar00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MSBR2_1391
   03410 Base excision repair
    MSBR2_1391
   03420 Nucleotide excision repair
    MSBR2_1391
   03430 Mismatch repair
    MSBR2_1391
Enzymes [BR:mbar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSBR2_1391
    6.5.1.6  DNA ligase (ATP or NAD+)
     MSBR2_1391
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MSBR2_1391
DNA replication proteins [BR:mbar03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MSBR2_1391
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MSBR2_1391
DNA repair and recombination proteins [BR:mbar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MSBR2_1391
   NER (nucleotide excision repair)
    Other NER factors
     MSBR2_1391
   MMR (mismatch exicision repair)
    Other MMR factors
     MSBR2_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKB57907
UniProt: A0A0E3R337
LinkDB All DBs
Position
1787400..1789106
Genome map
AA seq 568 aa AA seqDB search
MTSFREFAETCQAIEKISSTIDTTSRVADLLKKVDVEELPIATHFIMSEVFPAWSGEQLG
IGTSLLYVSLSKASGMTVKSIESLIRTTGDIGDTALLILKEKRKNQVTFSSFFEEQPELS
ITEVYNRFKIASEASGKGSQDIKIKNLQFLFTSSTPREAKYISRLALEELRIGVGEGVVR
DAIAKAFSVPADVVEHAFMVTNDLGIVAATAKEGGVEALESLGIEIKRPIKMMLSQISPD
IVADIKEMKEAAIEWKFDGARIQVHKAGDSVMLFSRKLENVTNSLPDLVEIVRKHVKAES
AILDGEAVAVDENGKPRAFQEILKRFRRKYDVEEKALGIPIQLNLFDIMYLNGKTLIDLP
LIERRKALESCVESSVEDSKSISVDKQVITGDLELIEKIYKEALDAGHEGVMVKNPNSFY
SPGKRGKNWLKKKPLMETLDLVIVGAEWGFGRRANLLGSYTVACYDPENLRFLQIGKVGT
GLTDDQLKELTEILSGLMEGGEAGGIFAIRPKIVLEIAFEEIQKSPNYDSGFALRFPRFI
RIRDDKDPEEADTIQRIGKVYSQQLKRL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtttcagggaatttgcagaaacctgccaggcgattgaaaaaatctcgagtaca
attgatactacaagtagggttgctgaccttcttaagaaggttgatgttgaagagctgccc
attgcaactcattttattatgagtgaggtttttcctgcctggagcggagaacaattggga
attggcactagcctgctgtatgtttcactttccaaagcctccggaatgacagtaaaaagt
atagaatctcttattcggactaccggagatataggggacacagcccttctgatcctcaag
gagaaaaggaaaaatcaggttactttttcctctttcttcgaagagcagcccgaactctca
ataaccgaagtttataaccgttttaagattgcctccgaagcctcaggaaaaggctcacag
gacattaagataaagaatcttcagtttctctttacttcctcgactccaagggaagcaaaa
tatatctccagacttgcgcttgaggaacttcgcataggcgtcggagaaggcgttgtaagg
gatgcaattgcaaaagctttttccgtgcctgcggatgtggttgaacacgcctttatggtt
actaatgacctggggatagtcgctgcaactgccaaggagggcggggtggaagccctggag
agtctcgggattgagatcaaacgcccgatcaagatgatgctctcacagatcagccctgac
atagttgctgacataaaggaaatgaaggaagctgcgatcgaatggaaattcgatggggca
agaatccaggttcacaaggccggagattcggttatgcttttttcacgaaagcttgaaaat
gtcacaaactcccttcctgaccttgtagaaatagtccgcaaacatgtaaaggccgaatcc
gcaatccttgacggagaagctgttgcagtggacgagaatggtaagcccagggcatttcag
gagatccttaaacgtttccggcgcaagtacgatgtggaagaaaaagcccttggcatccct
attcagctaaacctttttgacataatgtacttaaacggaaaaacgctgatagacctgcct
ctgattgagcggcgaaaagcgcttgaatcctgcgtggaaagctcggttgaggattcaaaa
tccatctccgtggacaaacaggtgataaccggagacctcgaacttatagagaagatctat
aaggaagccttagatgccgggcacgaaggagttatggtcaaaaatccgaattcgttttat
tcccctggtaaacgtggcaaaaactggcttaagaaaaagcctcttatggaaacccttgac
cttgtaatcgtaggagccgagtggggctttggcaggcgtgccaacctcctgggttcttat
acggttgcctgttatgacccagaaaacctgcgttttctccagatcggcaaagtgggtaca
ggcctgaccgacgatcagttaaaggaactcacagagatactttccgggcttatggaaggc
ggagaggcaggcggcatatttgcaatccggccgaaaatagtcctggaaatcgcctttgag
gaaatccagaaaagccccaattatgattcaggctttgcattgcgtttccctcgctttatt
cgtatccgggacgataaagatcccgaagaagccgatacgatacagagaattggaaaggta
tatagccagcagttgaaaaggttgtaa

DBGET integrated database retrieval system