KEGG   Methanosarcina barkeri 227: MSBR2_2945Help
Entry
MSBR2_2945        CDS       T03914                                 

Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase cofactor modifying protein
Organism
mbar  Methanosarcina barkeri 227
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPASM Radical_SAM Fer4_12
Motif
Other DBs
NCBI-ProteinID: AKB59461
UniProt: A0A0E3LR61
LinkDB All DBs
Position
3812392..3813267
Genome map
AA seq 291 aa AA seqDB search
MVVIGGGEPTLYPSFRDLIAYIDSLGIIPVIFSNTVLMTEELAGFLYKHNASVMGKLDSL
KPEVQDYLAGRAGASEDIRNGLRNLLKVGFSKPAESGELRMGVSFVSNKMNLEEIEEIWH
FCRQNNIFPNMEILTPTGRANDELEDKLLTADEIKEYKLKLLEIDRKYYGYDWLPYTPIT
ASGCLQHLYSLYINIEGNIRPCAPTKLDEHPALRVDGEYPYNVNKMSLREIYDSNLFKYV
RNIDKMLEGRCRNCEHNEECIGCRGYAYSVGVKHGIDPLKALRMECQQCFK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggttgtaattgggggaggagagccgaccctatacccgagtttcagggatttaatagct
tatattgattccctgggaataatcccggtgattttttcgaatacggttttgatgacagaa
gagcttgcagggttcctgtacaaacacaacgcctcagtaatgggaaagttagattccctt
aagcctgaagttcaggactacctcgcaggaagagcaggagcctccgaagatattaggaat
gggcttcggaatcttctcaaagtaggcttttcaaaacctgcggaatctggagaactccgt
atgggagtttctttcgtcagtaacaaaatgaatctggaagaaattgaggagatctggcat
ttctgcaggcaaaacaatatttttcccaatatggaaattctaacacctacaggcagggca
aatgacgaacttgaggataagctactcacggctgacgagataaaggaatataaattaaaa
ctgctggaaatcgaccggaaatattatggttatgactggctgccttacacaccgattact
gctagtggctgccttcagcacctttacagcctgtatatcaatatagaaggaaatatccgg
ccctgtgcgcctacaaagctggacgaacatcctgcgcttagagttgacggggaatatccc
tacaatgtaaataaaatgagccttcgggaaatttatgattctaatcttttcaaatatgtc
cgaaacatcgataaaatgctcgagggaaggtgcaggaactgtgaacataatgaagagtgc
ataggctgccgggggtatgcttacagcgtaggagtaaaacatggcatcgaccctcttaaa
gccctcaggatggaatgccagcagtgtttcaagtaa

DBGET integrated database retrieval system