KEGG   Labilibaculum antarcticum: ALGA_0551
Entry
ALGA_0551         CDS       T05376                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mbas  Labilibaculum antarcticum
Pathway
mbas00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ALGA_0551
Enzymes [BR:mbas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ALGA_0551
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ALGA_0551
    1.1.1.-  
     ALGA_0551
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD Pyr_redox_2 AlaDh_PNT_C Pyr_redox HI0933_like
Other DBs
NCBI-ProteinID: BAX78944
UniProt: A0A1Y1CF51
LinkDB
Position
complement(762212..763225)
AA seq 337 aa
MKATVYAGNKTFSVVEKEIEAPVAGDVRIKVAYCGVCGTDVHIYHGMMDKRVQIPQIIGH
EMSGIIDAVGDGVTDFKVGDKITVRPLDNRGEVDSDKGYSHIAKKLKFIGIDSPGAMQQY
WNVPAFTLHKLKESTDLKLAALIEPLSVACHDVRRGGLKAGETAVVSGGGPIGLLVALVA
RSKGANVIISEVNDIRVKMAEGMGFDVVNPMKNNLVEYVDKKTNGALADVVFEVAGVQAS
LDITTEVVGIRGRIVLVAIYGEAKPVNLFKFFWKELTLIGARVYEKEDYEESIQLITENK
YPFERIITDTKPLDQIQQLFESIDTTPEGMKFLVDCQ
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaaagcaacagtatacgcaggaaataaaactttctcggtagttgaaaaagaaatagaa
gcaccagtagctggtgatgttagaatcaaagtagcctattgtggcgtttgcggaacagat
gttcacatttatcacggtatgatggacaaacgagttcagattccacaaatcattggacac
gaaatgtcgggtattatcgatgctgttggtgatggggtaaccgattttaaagttggtgat
aaaattacagttcgtcctttggataatcgcggggaagttgattcagataaagggtatagc
catatcgctaaaaagctgaaatttatcggtattgatagtcctggagctatgcaacagtat
tggaatgttcctgcatttacattgcacaaattgaaggaatcaacagatttaaaactggcg
gccttaattgagcctctttctgttgcttgtcatgatgtgcgcagaggtggattaaaagca
ggagaaacagctgttgtttcgggtggcggacccattggtttattagtggccttggttgct
agaagtaaaggagccaatgtaattatttctgaagttaatgatattcgtgtcaaaatggct
gaaggaatgggatttgatgtagtaaatccaatgaaaaacaatctggtagagtatgttgat
aaaaagactaacggagctttggctgatgttgtgtttgaagttgcaggggtacaagcatca
ttggatataacaactgaggttgtaggtattcgaggacgtattgtattggttgcgatctac
ggcgaggccaagccagtgaatttgtttaaatttttctggaaggaattaacattaatcgga
gctcgtgtatatgaaaaagaggactacgaagagtcaatccaattaattaccgagaacaaa
tatccttttgaaagaattattactgatacaaaaccattggatcaaatccaacaacttttt
gaaagtatcgatacgactccagagggaatgaagtttttagtagactgtcaataa

DBGET integrated database retrieval system