KEGG   Marinifilaceae bacterium SPP2: ALGA_0551Help
Entry
ALGA_0551         CDS       T05376                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
Organism
mbas  Marinifilaceae bacterium SPP2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD Pyr_redox_2 AlaDh_PNT_C Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAX78944
UniProt: A0A1Y1CF51
LinkDB All DBs
Position
complement(762212..763225)
Genome map
AA seq 337 aa AA seqDB search
MKATVYAGNKTFSVVEKEIEAPVAGDVRIKVAYCGVCGTDVHIYHGMMDKRVQIPQIIGH
EMSGIIDAVGDGVTDFKVGDKITVRPLDNRGEVDSDKGYSHIAKKLKFIGIDSPGAMQQY
WNVPAFTLHKLKESTDLKLAALIEPLSVACHDVRRGGLKAGETAVVSGGGPIGLLVALVA
RSKGANVIISEVNDIRVKMAEGMGFDVVNPMKNNLVEYVDKKTNGALADVVFEVAGVQAS
LDITTEVVGIRGRIVLVAIYGEAKPVNLFKFFWKELTLIGARVYEKEDYEESIQLITENK
YPFERIITDTKPLDQIQQLFESIDTTPEGMKFLVDCQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacagtatacgcaggaaataaaactttctcggtagttgaaaaagaaatagaa
gcaccagtagctggtgatgttagaatcaaagtagcctattgtggcgtttgcggaacagat
gttcacatttatcacggtatgatggacaaacgagttcagattccacaaatcattggacac
gaaatgtcgggtattatcgatgctgttggtgatggggtaaccgattttaaagttggtgat
aaaattacagttcgtcctttggataatcgcggggaagttgattcagataaagggtatagc
catatcgctaaaaagctgaaatttatcggtattgatagtcctggagctatgcaacagtat
tggaatgttcctgcatttacattgcacaaattgaaggaatcaacagatttaaaactggcg
gccttaattgagcctctttctgttgcttgtcatgatgtgcgcagaggtggattaaaagca
ggagaaacagctgttgtttcgggtggcggacccattggtttattagtggccttggttgct
agaagtaaaggagccaatgtaattatttctgaagttaatgatattcgtgtcaaaatggct
gaaggaatgggatttgatgtagtaaatccaatgaaaaacaatctggtagagtatgttgat
aaaaagactaacggagctttggctgatgttgtgtttgaagttgcaggggtacaagcatca
ttggatataacaactgaggttgtaggtattcgaggacgtattgtattggttgcgatctac
ggcgaggccaagccagtgaatttgtttaaatttttctggaaggaattaacattaatcgga
gctcgtgtatatgaaaaagaggactacgaagagtcaatccaattaattaccgagaacaaa
tatccttttgaaagaattattactgatacaaaaccattggatcaaatccaacaacttttt
gaaagtatcgatacgactccagagggaatgaagtttttagtagactgtcaataa

DBGET integrated database retrieval system