KEGG   Marinifilaceae bacterium SPP2: ALGA_0720Help
Entry
ALGA_0720         CDS       T05376                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00500  Starch and sucrose metabolism
mbas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ALGA_0720
Enzymes [BR:mbas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ALGA_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C fn3
Motif
Other DBs
NCBI-ProteinID: BAX79109
UniProt: A0A1Y1CFH8
LinkDB All DBs
Position
complement(998229..1000343)
Genome map
AA seq 704 aa AA seqDB search
MKSKSILYLIAGFAMILTSCANSKPVQNVESPDGKIGVQFSMVEGQATYEVLFNGEKVIN
PSTLGFDFQNMPSIEKGWKIVDSQLSSSNSTWEMQWGEKRVVRDHYNELSLALEEQKAPN
RKMNLVFKVYNDGLGFRYEFPEQEAMKEAIITDENTQFNLTGDHKVWWIPGDWDIYEHLY
HTTSLTGIDALALRANDNLAQSYIPENAVNTPVTMKTAEGVYLSFHEANLTDYAGMTLKV
NKEKLMLESELVGSDITGYKVKRAVPFNTPWRTIQISENAGGLIESDLIVNLNEPNKIGS
VSYFKPMKYVGIWWDMHLGTKTWDYGASQDMNTATGLKPNGRHGATTEYAKELIDFASEN
NIGGILVEGWNTGWEHWIGFEDREGVFDFVTPYDDYDLKEVVRYGKEKGVELIMHHETSA
APRTYNQQMDTAYQLMNSLGIHSVKTGYVGKIIPKGEYHHGQWMVNNYRRAVETGAKYQV
AVNAHEPIKATGLRRTYPNIISREGLRGQEFNAWASDGGNPPEHLSIVAFTRMLAGPIDY
TPGIFNIKLTPYKPNNQVNTTLAQQLALYVVINSPIQMVPDLIENYKGNDAFQFIRDVAV
TWETSKVLNGEIGDFVTIARKDRNSENWFVGSITDENARDMEFSLDFLTPGKKYKATLYL
DGENAHWDKNPTEFKIVEMEVSSTSSLKYHLAEGGGAAISLIEL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaatcaattctttacctgattgctggttttgcaatgatattgacatcttgt
gccaatagcaaaccagtccagaatgttgaatcgccggatggaaaaattggcgttcaattc
agtatggtggaaggacaagccacttacgaggttttattcaatggtgaaaaagtaattaat
ccttctactttgggtttcgattttcagaatatgccttctatcgaaaaaggatggaaaatt
gttgactcccaactttcatcaagtaattcaacttgggaaatgcagtggggagagaaacga
gttgtgagagatcattacaatgaattgagtttggctttagaagagcaaaaggcgccaaac
cgaaaaatgaatttggtatttaaggtctataacgatgggctaggatttcgttatgagttt
ccggaacaagaagccatgaaagaggcgattattaccgacgaaaacacacagtttaatctt
accggagatcataaggtatggtggattccgggtgactgggatatttacgaacatttgtat
catacaacttcactaacgggtattgatgctctagctttgcgagccaatgataatttggct
caatcttatatccctgaaaatgctgtgaacactcctgttactatgaaaacagcagaaggt
gtttatttgagttttcatgaagcaaatctgactgattatgcaggaatgaccttgaaggta
aacaaagagaagttgatgctggaaagtgaattggtaggttcggatataacgggctacaaa
gtaaaaagagccgttccttttaatacaccttggagaaccattcaaatttctgaaaatgca
ggaggtcttattgaatccgacttgatcgttaatttgaacgaacccaataaaattggatcg
gtgtcttattttaaacccatgaaatatgttggtatctggtgggatatgcatttgggaaca
aaaacctgggattacggagcatctcaggatatgaataccgcaacaggtttgaagccaaat
ggccgacatggtgccacaaccgagtatgcaaaagagttgatcgattttgcttcggaaaat
aacattggtggtattttggtcgaaggatggaacacaggttgggagcattggatcggtttt
gaggatcgcgaaggagtattcgattttgtaacaccatacgacgactacgatttaaaggaa
gttgttcgttacggaaaagaaaaaggtgttgagttgatcatgcatcacgaaacctcagca
gctcccagaacttacaaccagcaaatggatacagcctatcaattgatgaattcattggga
attcactcggtaaaaacaggatatgttggtaagattatcccgaaaggagaatatcatcac
ggacaatggatggtgaacaattaccgaagagctgttgaaactggtgctaaataccaggtt
gcggttaacgctcacgagccaattaaagcaacaggtttgcgtcgtacctatccaaatatt
atttctcgtgaaggattgcgcggacaagaatttaatgcatgggcaagcgatggaggaaat
ccgccggagcatttatcaattgttgcgtttactcgtatgttggcaggtcctattgattat
acgcctggtattttcaatatcaagttaacaccatataaaccaaacaatcaggtgaacaca
actcttgctcagcaattggctttgtatgtggttattaacagtccgattcaaatggtgccc
gatttaattgagaattacaaaggaaacgatgcatttcaattcattcgtgatgtagctgtt
acctgggaaaccagtaaagttttgaacggtgaaattggtgattttgtgaccattgcccgt
aaagatcgtaattctgaaaattggtttgtaggatcaataacggatgaaaatgcacgtgat
atggagttcagtttagatttccttactccaggtaaaaaatacaaagcaacactctatttg
gatggggaaaatgctcattgggataagaatcctacggaatttaaaattgttgaaatggaa
gtaagtagtacttcaagtttaaagtatcatttagcagaaggtggtggcgcagccataagc
cttattgaattatag

DBGET integrated database retrieval system