KEGG   Marinifilaceae bacterium SPP2: ALGA_1731Help
Entry
ALGA_1731         CDS       T05376                                 

Definition
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00190  Oxidative phosphorylation
mbas01100  Metabolic pathways
Module
mbas_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ALGA_1731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:mbas00194]
    ALGA_1731
Enzymes [BR:mbas01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     ALGA_1731
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     ALGA_1731
Photosynthesis proteins [BR:mbas00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ALGA_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N T3SS_ATPase_C NACHT NB-ARC RsgA_GTPase AAA_7 AAA_19
Motif
Other DBs
NCBI-ProteinID: BAX80105
UniProt: A0A1Y1CIF3
LinkDB All DBs
Position
complement(2247715..2249229)
Genome map
AA seq 504 aa AA seqDB search
MSQNTGKIVQVIGPVIDVSFDKEGSKLPEIYDSLEVVIENGKNLVLECQQHIGENTVRTI
AMDSTDGLRRGMDVIATGSPIMMPPGDKIKGRLLNVIGETIDGIGPVSKEGGNAIHRTPP
AFDELSTESVVFFTGIKVIDLIEPYAKGGKIGLFGGAGVGKTVLIQELINNIAIGQEGLS
VFAGVGERTREGNDLLREMIESKVIQYGDAFEKNMEKGGWDLSLVDKEALDKSQVSLVFG
QMNEPPGARARVALSGLTVAESLRDGDEKTGGRDILFFVDNIFRFTQAGSEVSALLGRMP
SAVGYQPTLSSEMGVMQERIASTKRGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLN
RKIAELGIYPAVDPLDSTSRILTVDVVGEAHYKCAQDVKEMLQRYKELQDIIAILGMEEL
SEEDKLIVHRARRVQRFLSQPFYVAEQFTGLKGCLVSIEDTIKGFNMIMDGEVDQYPESA
FNLVGTIEDAIKKGEKLLAQAEEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaatacaggcaaaattgtacaggttattggacctgttatcgatgtaagtttt
gataaagaaggaagcaagcttcctgaaatttacgattctttagaggtcgtgattgaaaat
ggtaaaaatttggttcttgagtgtcagcaacatattggtgagaatactgttcgtaccatt
gcaatggattcaaccgatggattacgtcgtggaatggatgtaattgcaaccggttcgcct
attatgatgcctcctggagataaaattaaaggtagattgcttaatgtgattggggaaacc
attgatgggattggacctgtaagtaaagaaggtggtaatgctattcacagaactccgccg
gcatttgatgagttaagtactgaatcggtagttttctttactggaattaaagtaattgac
cttattgagccatatgcaaaaggtggtaaaattggtttgtttggaggtgctggtgttggt
aaaacagtattgattcaggaattaataaataacattgccattggtcaagaaggtttatct
gtatttgctggtgttggtgagcgtactcgtgaaggaaatgatttgcttcgggaaatgatc
gaatcaaaggttattcagtatggagacgcatttgaaaaaaatatggaaaagggaggatgg
gacctttctttagtagataaagaagctctcgataaatctcaggtttcacttgtttttggc
cagatgaatgaaccaccaggggcacgtgcccgtgttgctctttctggattaactgttgcg
gaaagtttacgtgacggtgatgaaaaaacaggtggacgtgatattcttttcttcgtagat
aatattttccgatttactcaggctggttctgaggtttcggcattgcttgggcgtatgcct
tcggcagtaggttaccagccaacactatcatcagagatgggtgtgatgcaggagagaatt
gcttcgacaaaaagaggttcgattacatcggtacaggcggtttacgttcctgcggatgac
ttgacagacccggctccggcaacaacttttgctcacttggatgcaaccactgtattgaat
cgtaagattgcggagttaggtatttatccagcggtagatcctttggattctacttctcgt
attcttaccgtagacgttgttggtgaggctcactataagtgtgcgcaagatgtaaaagaa
atgcttcagcgttacaaagaattgcaggatatcattgcaattttgggtatggaagagctt
tcagaagaggataaattgattgtacatcgcgctcgtcgtgtacaaagatttttatcacaa
ccattctatgttgccgagcagtttactggtttaaaaggatgtttggtttctattgaggat
accattaaaggctttaatatgattatggatggagaggttgatcaatatcctgaatcagca
tttaaccttgttggtacaattgaagacgctatcaaaaaaggagaaaaattgttagcccaa
gctgaagaagaataa

DBGET integrated database retrieval system