KEGG   Marinifilaceae bacterium SPP2: ALGA_2374Help
Entry
ALGA_2374         CDS       T05376                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00240  Pyrimidine metabolism
mbas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ALGA_2374
Enzymes [BR:mbas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ALGA_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-dskA_traR
Motif
Other DBs
NCBI-ProteinID: BAX80701
UniProt: A0A1Y1CN66
LinkDB All DBs
Position
3068895..3069476
Genome map
AA seq 193 aa AA seqDB search
MFLENDINRTGRNGWIEVIVGSMFSGKTEELIRRLNRAKIARQNVEIFKPHIDVRYSVDE
VVSHNSNSIRSTPVETSANILLLASNVDVVGIDEAQFFDVGLSEVCNELANQGIRVIVAG
LDMDFKGNPFGPVPSIMATAEYVTKVHAVCMRCGNLANYSHRLAEAEKLVLLGEKSEYEP
LCRDCYQKIYRTS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgagaatgacattaacagaactggcagaaatggttggatcgaagtaatagtc
gggtctatgttttcgggtaaaaccgaagaattgattcgtcgattgaatcgggcaaaaatc
gctcgtcagaatgttgagatatttaaacctcatatcgatgtgagatactctgtggacgaa
gtggtttcgcataattccaattcaattcgatcaactcccgttgaaacatctgcaaatata
ttgttgctagccagtaatgttgatgttgtgggtattgatgaagctcaattttttgatgtt
ggcttatccgaagtttgtaacgaattggccaatcagggtattcgtgttattgttgctggt
ttggatatggattttaaaggaaatccttttggtccagtcccaagtataatggccacagcc
gaatatgttaccaaagttcatgcagtttgtatgcgttgtggaaatttagccaactattct
catcgtttagccgaggctgaaaaattagtgttgttgggcgaaaagagtgaatatgaaccg
ctttgcagagattgttatcaaaaaatttatcgaacatcctaa

DBGET integrated database retrieval system