KEGG   Marinifilaceae bacterium SPP2: ALGA_2375Help
Entry
ALGA_2375         CDS       T05376                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00473  D-Alanine metabolism
mbas01100  Metabolic pathways
mbas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ALGA_2375
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ALGA_2375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbas01011]
    ALGA_2375
Enzymes [BR:mbas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ALGA_2375
Peptidoglycan biosynthesis and degradation proteins [BR:mbas01011]
 Precursor biosynthesis
  Racemase
   ALGA_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C Sds3
Motif
Other DBs
NCBI-ProteinID: BAX80702
UniProt: A0A1Y1CL32
LinkDB All DBs
Position
3069497..3071971
Genome map
AA seq 824 aa AA seqDB search
MTFAQFYTIESVASITGGVCYGKENLSIKTLSIDSRSLQLPGETLFFALVGERHDGHLYI
KDLYKKGVRAFVVNNLESVDSKQFPNAAFVLVPDTLRALQNLAQNHRKNFLYPVFGITGS
NGKTITKEWLYQLLNESYSIVRSPKSYNSQVGVPISVWHMNNEVNLAIFEAGISQPGEMD
QLSKIIQPTFGIFTHLGDAHRENFKSEVQKLEEKIKLFSSCNSIVYCSDKKLVDESLKAR
YGRDKELISWSRNHAANLKIVSEEIKGSRTFIKAKYKKKSKEINLSFTDKASIDNAITCW
LCLLNLNVDDKTIKEGFLKLEPVAMRLEIKEGIGDCTLINDYYNSDLDSLGIALDLMNQQ
QNDKRKTLILSDIFQSGYTNRQLYKAISKLLEQKKINRLIGIGEGISSQSKLFKCDASFY
GSTDVFLADLNRNHFKDEIILIKGARNFHFERISNALQYKAHQTVLEVNLNAMVHNLNYF
RSLLNPDTKLIVMVKAFSYGSGSTEIANLLQHHRVDYLAVAIADEGVELRNAGITIPIIV
MNPEYHSFDTMIEYSLEPEIYNQAICLEFEKALKRNGVRNYPIHIKLDTGMNRLGFVQKD
MDTLLSVIVKNNHFFISSVFSHLAGADEQQHNDFTAQQINLFTKWSDQILSQFPYHIDRH
ILNSAGIERFPQAQFDMVRLGIGLYGISCVHQEKLMNVSSLKTAISQIKEVSKENTVGYG
RKGHLQSDARIGVIPIGYADGFNRKLGNGLGKVLVNGQAAPVVGNICMDMSMIDLTNTDA
KEGDLVQIFGDDYPVSILAEQLDTIPYEILTTISRRVKRVYFQG
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgcacaattttatactatcgaatcggtagcttctataacaggaggtgtatgt
tatgggaaagaaaatctctctattaaaaccctttcgatagacagcaggtcattgcaactt
cccggagaaacacttttttttgctttagtgggcgagcggcacgatggtcatttatacatc
aaagatttatataaaaaaggggttcgggcatttgttgtaaacaatttggaaagtgtagat
tccaaacagtttcctaatgccgcttttgtattggttcccgatacgcttcgggccttgcag
aatttggcgcaaaatcaccgtaagaactttttatatcccgtatttggaattaccggcagc
aatggaaaaaccattacaaaagaatggttgtatcaattactcaacgaatcgtattctatt
gttcgaagtcccaaaagctataattctcaggttggggttccaatttctgtttggcacatg
aacaatgaggtcaatttggccatttttgaggctggtatttctcaacctggagaaatggat
caactctcaaaaattattcaacctaccttcggaatttttactcatttgggagatgcccat
cgggagaattttaagagtgaagttcagaaattagaagagaagataaaattattctcttcc
tgcaattccattgtgtattgttccgataagaaacttgttgatgaatcgttaaaggctcga
tatggacgggataaagaattgatatcctggtcaagaaatcatgcagccaatctgaagatt
gtttcggaagaaataaaagggagtagaacatttattaaagctaaatataagaagaaatca
aaagagataaatttatcttttaccgacaaggcttcaattgataatgccataacttgctgg
ctttgtttgttgaacctgaatgttgatgataaaaccataaaagagggatttctgaaattg
gaaccggttgccatgcgactggaaatcaaagagggaattggtgattgcacgctgattaat
gattattacaattcagatttagattcgctcggtattgccttggatttaatgaatcagcaa
caaaacgataagagaaaaacacttatcttatctgatatttttcaatcgggttacacaaac
cgtcagctttacaaggcgatatccaaattgctggagcagaagaaaataaatcgtctaatt
ggtattggtgaaggcatttcttctcaatcgaaactattcaagtgcgatgcttctttttat
ggctcaaccgatgtgtttttggccgatttgaatcggaatcattttaaggacgaaattatt
ttgataaaaggagcccgaaatttccatttcgagagaatttcaaatgctcttcaatacaaa
gcacaccaaacggtgttggaagtgaatctgaatgcaatggttcataacctgaactatttc
aggtccttgttaaacccagataccaagttgattgtgatggtaaaagcattttcttacgga
agcggatcaaccgaaattgcaaatttactgcaacatcatcgggttgattatttagccgtt
gccatcgccgacgaaggtgtcgaattgagaaatgcaggaatcacgattccaattatagtg
atgaatccggagtatcacagttttgatacgatgattgaatatagcctggagcctgaaata
tataatcaagctatttgtctcgaatttgagaaggcattaaaacgaaatggagtaagaaac
tatcctatccacataaaattggataccggaatgaatcgtttgggttttgttcaaaaggat
atggacactttattgtctgtgattgtgaagaataatcatttctttatcagctctgtattt
tctcatctggcaggtgccgatgagcaacagcataacgattttacagctcagcaaattaat
ttatttaccaaatggagcgatcaaattctatcgcaatttccgtatcatatcgatcggcat
attttaaattcggcaggaattgaacgattcccgcaagctcaatttgatatggtgcgcttg
ggaattggtctttacggaataagctgcgttcatcaggaaaaattgatgaatgtgagcagc
ttaaaaacggcaatctctcaaattaaagaagtttcgaaagagaacactgttggatatggc
cgaaaagggcatttacagagcgatgcacgaataggggtaatcccaatcggttatgccgat
ggttttaatcgaaagctcggtaatggccttggaaaggttctggtgaacggacaggcagct
cctgttgttggcaatatttgcatggatatgagtatgatcgatctcacaaataccgatgca
aaagagggagatttggttcagatttttggcgacgattacccggtaagcattctggctgaa
caattggatactattccttacgaaattctcaccaccatttcccgacgggtgaaacgcgtt
tattttcaggggtag

DBGET integrated database retrieval system