KEGG   Marinifilaceae bacterium SPP2: ALGA_3260Help
Entry
ALGA_3260         CDS       T05376                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00564  Glycerophospholipid metabolism
mbas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ALGA_3260
Enzymes [BR:mbas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ALGA_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAX81560
UniProt: A0A1Y1CMP2
LinkDB All DBs
Position
4201582..4203144
Genome map
AA seq 520 aa AA seqDB search
MERDKMIREIEEIDCKWDVIIIGGGASGLGAAIESTTRGYKTLLLEQGDFAKGTSSRSTK
LVHGGVRYLAQGNISLVLEALRERGLMKQNAPHLVKDQSFIIPNYTWWGTPYYTLGLTMY
DLMAGKLSYGRSLPFSKKRTLKHIPTLQDKNLCGGVVYHDGQFDDARLAINLCQTFVENG
GVAINYMKVGGLKKTNGKVNAVFVTDMESGSKYTLEAKVILNATGVFVDEIIKMDEPKAR
DIVKVSQGVHLVLDKEFVPGDHAIMIPKTSDGRVLFAVPWHGKVVVGTTDVPKDSAELEP
RALEEEVDFILETAGRFLTKPPKRSDVRSVFAGLRPLAAPSGEGKKTKEISRGHKIVVSK
SGMVTITGGKWTTYRQMAEDVIDTVAKTGEFPEKKSITRNLKIHGYKNGVDLNNPLYFYG
ADEEQILALAKKEVGLEEYLSEKLKVINAQVVWGARHEMARTVEDILSRRTRCLLLDAKE
SIVMAPKVAELLAKELGYDKQWEENQIKEYSELASRYILK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagataagatgattcgggaaattgaagaaatcgattgtaagtgggatgttatt
atcattggtggtggtgcttcaggtttgggagctgctattgaatcaactacaagaggttat
aagaccttattgttggagcaaggtgattttgcaaaggggacatcaagcagaagtaccaaa
ttggtgcatggaggagttcgttatttagcccagggaaatatttcactcgttttggaagct
cttcgtgaaagagggttgatgaagcagaatgctcctcacttagttaaagatcaatcattt
atcattcctaattatacttggtgggggactccttactacaccttggggcttaccatgtac
gatttgatggccgggaaattaagttatggtcgttcattaccattctcaaaaaaacgtact
ttaaaacacattccaactctacaggataagaacctttgcggtggagttgtttatcatgat
ggtcagtttgatgacgcccgattggcaattaatttgtgccaaacatttgtagaaaatggc
ggtgttgccataaactacatgaaagtgggtggcttaaagaaaaccaacgggaaagtaaat
gccgtttttgtaacagatatggaaagcggttctaaatatactttggaagcaaaggtgatt
ttaaatgccacaggtgtattcgttgatgaaatcatcaaaatggatgaaccaaaagcaaga
gatatcgtaaaagttagccaaggagttcatttggtgttggataaggagtttgtacctggt
gatcatgctattatgattccaaaaacatcagacgggcgtgtattgtttgcagtgccttgg
catggtaaggttgtagttggtacaacagatgtaccgaaagatagtgcagagttggaacca
agagccttagaagaggaagttgactttattttagaaacagcaggtcggtttttaacaaaa
cctccaaaaagatctgacgtaagaagtgtatttgcaggtttaagacctttggctgcaccg
agtggtgaaggtaaaaagaccaaagagatttcgagaggacacaaaatcgttgtttcaaaa
tcgggaatggtaactataacaggaggtaagtggactacttatcgtcaaatggcagaggac
gttattgacactgtagcaaaaacaggtgagtttcctgaaaagaaatcgattacccgtaat
ttaaaaatacatggctataagaacggcgtagatctaaacaatccattgtatttctatggt
gctgatgaggaacagattttggctctagctaaaaaagaagtaggattagaagagtacttg
agcgaaaaattaaaagtgattaacgctcaggtggtttggggagcaagacacgagatggcc
agaacggttgaagatatattatcccgtagaacaagatgtttgcttttggatgcaaaagaa
agtattgtgatggcacctaaagttgctgaattgttggccaaagaattaggctacgacaaa
caatgggaagaaaatcagattaaagaatatagtgagttagcatctcgatatatattaaaa
tag

DBGET integrated database retrieval system