KEGG   Marinifilaceae bacterium SPP2: ALGA_3668Help
Entry
ALGA_3668         CDS       T05376                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00620  Pyruvate metabolism
mbas00680  Methane metabolism
mbas01100  Metabolic pathways
mbas01120  Microbial metabolism in diverse environments
mbas01200  Carbon metabolism
Module
mbas_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ALGA_3668
  09102 Energy metabolism
   00680 Methane metabolism
    ALGA_3668
Enzymes [BR:mbas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ALGA_3668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAX81960
UniProt: A0A1Y1CNU3
LinkDB All DBs
Position
4711163..4713712
Genome map
AA seq 849 aa AA seqDB search
MRSEKFQNEVDLKYKLYNSIFLTLPLDGIHGTGILIPILKDSCSKGLDTGKSPVEIFENF
FEKQTSFRTEKEQFDFMFRVIHYIERQVVLLDAVEDAVFDKMNDLDGAGSLKALKAEIKE
LGKGEGFKRDLEKFAVRVVLTAHPTQFYPSTVLAIINDLIKSIQKSDLLQIKLLLTQLGK
TPFFKKERPTPYDEAKSLSWYLENIFYQSASDLYSELLNNEELSDEMVCPTISFGFWPGG
DRDGNPYVNTETTLKVAERLRYILFSNYYKDLRLLRRRFSFKGVYELIVDLEEKVLKALN
KSESGTGISVEEINISLKKIEKILIEEHDGFFLDLLKKFQNKVKLFGAHFASIDIRQDSR
IIKTAFDVLCESSPVINKQIGDLSMENLFELNGSVTSIQTDDEVSKDTITVFSAIKEIQE
RNGESACNRFIISNCQTSVDVARVFAMAKLCAWEETLPLDIVPLFETIDDLAKADETMRE
LFENKVYYQHLLSRGKKQTVMVGFSDGTKDGGYFSANWSIYKAKENITRLAREKGIVVVF
FDGRGGPPARGGGNTHKFYSSLGNNIENQEIQVTIQGQTISSKFGTKASAKYYQELLITA
GLGNRLFEDRSKQLCLKDKEIMETLSQYSLEEYHRFKSSDKFVPYLEKMSALKYYGKAKI
GSRPSKRKASAELNFEDLRAIPFVGAWSQMKQNVPGFFGVGASIKRLKDEGRMEGCKSLY
NNSLFFRTLVENSMQSISKSYFSLTEYMKKDEEFGEFWNWIYREYQLSIDMLLEVSGQKE
IMELSLELKDSIHLREEIVLPLICIQQFALMKIREMDLSGNIDQNKYITLQNLVIRSLYG
NINASRNSA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgagatctgaaaaattccaaaatgaagttgatttaaagtacaaattgtacaatagtata
tttttaaccttgccgttagatggcatacatggaacgggtattttaattcccattctgaaa
gattcatgctctaaaggcttagatacagggaaatcacctgttgaaattttcgagaacttt
tttgagaaacaaacttcttttcgaactgagaaagaacagtttgattttatgtttcgtgtg
attcattatattgaacgacaggtagttttgctggatgcagtggaagacgcagtctttgat
aaaatgaacgatttagatggagccggtagtttgaaggcattgaaagcggaaattaaagaa
cttggtaaaggagagggatttaaacgtgatttggagaaatttgccgtgcgggtagtatta
acggctcatcctacgcaattttatccaagcacggtgttagcaatcattaatgatttaata
aaatccattcagaaaagtgatttacttcaaattaaattattgctcacgcaattgggaaaa
acgccgttttttaagaaggaaagaccaacaccatacgatgaggctaaaagtttaagctgg
tatttggagaatatattttatcagtcggcatctgatttgtattccgaattgctaaataat
gaagaattatctgatgaaatggtttgccctacaatttcatttggcttttggccaggtgga
gacagagatgggaacccctatgtaaatacagaaacgacattaaaagttgctgaacggctt
cggtatattcttttctctaattattacaaggatttgagactcttgcgaagacgttttagt
tttaaaggcgtgtatgagctaattgttgatttggaagaaaaggttcttaaggcattgaat
aaaagcgaatctggtactgggatttctgttgaggaaataaatatttcgttaaaaaaaatt
gaaaaaatattaattgaagaacacgatggtttttttcttgatttattgaagaaatttcag
aataaggtgaagttatttggtgctcattttgccagtattgatatccggcaggacagtcga
atcataaagacagctttcgatgttttatgtgaatcttctcctgttatcaataagcaaatt
ggcgatcttagtatggaaaatttgtttgaattaaatgggtctgtcacttctattcagact
gatgatgaggtgagtaaggatacgattactgttttttctgccataaaagaaattcaagaa
agaaatggggagtctgcttgtaatcgtttcattatcagtaattgtcagacttccgttgat
gttgcgcgagtattcgcaatggctaaactttgcgcatgggaagaaactttaccgctggat
attgtgccactttttgaaacaattgatgatttggcaaaggcagatgaaacaatgagggag
ttgtttgaaaataaagtatactatcagcatttattatcgagaggtaagaagcaaaccgta
atggttggcttttcggatggaaccaaagacggtggctatttttcggcaaattggagcatt
tataaagccaaagagaatataacacgtttggctcgtgaaaaagggattgtggtggtcttt
tttgatggacggggcggaccgccggcgcgaggaggcgggaatactcacaaattttattct
tccctaggaaataatatcgaaaatcaggaaatacaagtaactattcaaggtcagaccatt
agttcgaaatttggaactaaggcatctgcaaaatattatcaggaattactgattactgca
ggcttgggaaatcggttgttcgaagatcggagcaaacaattgtgtcttaaagacaaggaa
atcatggaaactctttcacaatatagtttggaggaatatcatcggtttaaatcatcggat
aagtttgttccttatttagagaaaatgagtgcgctaaaatactatggaaaagcaaagatt
ggtagtcgacccagcaaacgaaaggcatcagcagaattgaattttgaagatttacgggca
attccttttgtaggagcatggagccagatgaagcaaaatgtaccaggtttttttggtgtt
ggagcatctataaaaaggttgaaagatgaaggacgaatggaaggctgcaaaagtttgtac
aataattcattattttttagaactttggttgaaaacagcatgcaatccatcagtaaatct
tatttttcattaactgaatacatgaaaaaggatgaggagtttggcgaattttggaactgg
atttacagggaatatcaattaagtattgatatgttgttggaagtgtccggacaaaaggaa
atcatggaattatcactggaattaaaggattcaattcatttacgtgaagaaattgtattg
cccttaatatgtatccagcaattcgctttaatgaaaattcgggaaatggacttgtccgga
aatattgatcagaataaatatatcacattgcaaaacttggttattcggtcactttatggt
aatattaatgctagtagaaattcagcgtaa

DBGET integrated database retrieval system