KEGG   Candidatus Methylopumilus planktonicus: BN1208_0146Help
Entry
BN1208_0146       CDS       T03869                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbat  Candidatus Methylopumilus planktonicus
Brite
KEGG Orthology (KO) [BR:mbat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN1208_0146 (ahpF)
Enzymes [BR:mbat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN1208_0146 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 DAO FAD_oxidored K_oxygenase Thi4 Glutaredoxin FAD_binding_3 FMO-like NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CEZ19041
UniProt: A0A0D6ETV0
LinkDB All DBs
Position
1:140137..141690
Genome map
AA seq 517 aa AA seqDB search
MALDITIKNQLKDYMARLVNPIKLLANLDETASSQEMLEMLDEVASLSEKITLNKETDVS
KRIPSFEVNRETDLTGITFAGIPSGHEFTSFVLALLQAGGHPIKIDAEKIEQIKNIQGKF
HFETYISLSCHNCPDVVQALNAMSIINSHISHVMIDGALFQKEVEDKQIMAVPTIFLNGK
PFGQGRMELDEIVNKIDSSASLKEAEKISKKETYDILIVGGGPAGASAAVYSARKGLRTG
IVSERFGGQVMDTLGIENFISVKATEGPKLVTALEEHVKEYDVDIMNLQRAKSIQKNDEN
ALFEVELENGGQLKSKSVIVATGARWRELNVPGEKEFKGKGVAYCPHCDGPLFKGKHVAV
IGGGNSGVEATIDLANIVGHVTLFEFAPELKADDILQKRLYSLSNVDVILNAQTLEVLGT
DKVNSMIYLDRKTNEKKTIPLEGIFIQIGLLPNTDFVKNTVDLSKFGEIIIDSHGQSSLK
GLFAAGDATTVPYKQIIIAMSEGAKASLGAFDYLIRQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgatataacaattaaaaatcaattaaaagattacatggctaggcttgtcaat
ccgattaagcttctggcaaatcttgacgagacagcttcatctcaagaaatgctcgagatg
ttagatgaagttgcttctttgtcagaaaaaataactttaaataaagaaacagatgtttct
aaaagaattccctcttttgaagtcaatcgagaaacagatcttacgggtataactttcgca
ggcattccctcgggacatgaatttacgtcatttgtgttggctttgcttcaggcaggcgga
catccaataaagatagacgctgaaaaaatagagcaaattaaaaatattcaaggcaagttt
cattttgaaacttatatttcgttgagttgccataattgtcctgatgttgttcaggcgctg
aatgcaatgtctattattaattcacacatttcgcacgtcatgatagatggcgcattattt
cagaaggaagtagaagataaacaaattatggctgtacctactatctttcttaatggtaag
ccttttggtcaaggaagaatggagcttgatgaaattgtaaataagatcgactcaagtgct
agcttaaaagaagctgagaaaatttccaaaaaagagacatacgatattttaattgttggc
ggtggtccagctggagcttcagctgctgtatatagtgcacgaaaaggccttcgaacagga
atcgtgtccgagcgttttggtgggcaagtgatggatactttaggcatagaaaattttatt
tcagtcaaagctacagaagggccaaaattagtaacagctcttgaagaacacgtgaaggaa
tacgatgttgatattatgaatttacagcgtgcaaagagtattcaaaaaaatgatgaaaat
gctttatttgaagtcgagctagaaaatggtggacagcttaaaagcaaatcagtgattgtt
gcaacaggtgcaagatggagggaattaaatgttcctggcgaaaaagaatttaaaggtaag
ggtgtagcttattgcccacattgcgatggacctttatttaaaggtaaacacgttgcagtc
ataggtggaggaaactctggcgttgaggctactattgatcttgcaaatatcgtagggcat
gtcacgctttttgaatttgccccagaactcaaagctgacgatatcttacaaaagagactc
tatagcttgtcaaatgtagatgtcatattaaatgcacaaaccttggaagtccttggcact
gataaagtgaatagcatgatttatcttgatcgaaaaacaaacgaaaagaaaacgattcca
cttgaaggcatttttattcaaattggacttttgccaaatactgactttgtaaaaaatact
gtagatctctctaagtttggagaaattattattgatagtcatgggcaatcttcattgaaa
ggacttttcgcagctggggatgccactaccgtgccttataaacagattattattgcaatg
agcgagggcgctaaagcttccttaggagcttttgattacttgattcgccaataa

DBGET integrated database retrieval system