KEGG   Candidatus Methylopumilus planktonicus: BN1208_0869Help
Entry
BN1208_0869       CDS       T03869                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase B
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mbat  Candidatus Methylopumilus planktonicus
Pathway
mbat00010  Glycolysis / Gluconeogenesis
mbat00620  Pyruvate metabolism
mbat01100  Metabolic pathways
mbat01110  Biosynthesis of secondary metabolites
mbat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN1208_0869 (aldB)
   00620 Pyruvate metabolism
    BN1208_0869 (aldB)
Enzymes [BR:mbat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BN1208_0869 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CEZ19754
UniProt: A0A0D6EWC7
LinkDB All DBs
Position
1:816464..817984
Genome map
AA seq 506 aa AA seqDB search
MGLETLNNLGVKHPFKAKYDNYIGGKFVPPLDGKYFENISPVTGKVFCEVARSNEKDINL
ALDAAHAAKDGWAKKSPTDRANILMQVADIMEKNLSTIAIAETIDNGKPLRETTYADIPL
AIDHFRYFASCVRAQEGSIGEIDHETMAYHFHEPLGVVGQIIPWNFPILMAAWKLAPAIA
AGNCVVIKPAEQTPVSLLVVLELVGHLIPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTG
ETSTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVMDKDDNFFDKALEGFTMFALNQGEV
CTCPSRALIQESIYDKFMERGLKRVAAIKQDNPLDMATMIGAQASSEQVEKIMSYMKIGQ
EEGAQLLIGGNRKKLGGEFAEGYYIEPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEDEAL
EIANDTLYGLGSGVWSRNGNRAFRMGKGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSENKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggcttagaaacattaaataatcttggagtaaaacatccatttaaggctaaatatgac
aattatattggcggtaaatttgtacctccactagacgggaaatactttgaaaatatatca
ccagtgactggcaaagtattttgtgaagttgcacgatcaaacgaaaaagatattaatcta
gcgctagacgcagcgcatgcagccaaggatggctgggcaaaaaagagtcctactgaccgc
gcaaatatattgatgcaggtagcagacatcatggaaaaaaatctttcaacgattgcgatt
gctgaaacaatcgataatgggaaacctcttcgcgaaacaacttatgctgacattccatta
gcgattgatcactttagatacttcgcaagttgtgtaagagctcaagaaggcagtatcggt
gagattgatcacgagacaatggcttaccattttcatgagcctttaggtgttgtcggacaa
attattccttggaacttccctattctaatggcagcctggaaattagcgcctgcgattgct
gcaggaaattgtgttgtgattaaaccagcagaacaaacacctgtatcacttctagtcgtg
cttgaattagtaggacatctgattcctcctggtgtattaaatattgtgaatggcttcggt
ttagaagctggtaagccacttgcaagctcaccacgtattgcaaaaattgcattcacaggt
gaaacgtcaacaggtcgtttgattatgcaatatgcatcacaaaatcttattccagtaact
ttagaacttggtggtaaatcgcctaacatcttctttgaagatgtgatggataaagacgat
aacttctttgataaagcacttgagggctttacaatgtttgcgcttaatcaaggtgaagtg
tgcacctgcccttcacgagctttaatacaagaatctatttacgataaatttatggaacgc
ggactcaaacgtgttgcagctatcaaacaagataatcctcttgatatggcaaccatgatt
ggcgctcaagcatcgagtgaacaagttgaaaaaattatgtcttatatgaagattggtcaa
gaagaaggcgctcaactcctcatcggcggtaaccgtaaaaaattaggtggtgaatttgca
gaaggatattacattgaacctactgtttttaaaggtcataacaaaatgcgtattttccaa
gaagaaatttttgggccagtcgtttctgtaaccacatttaaagatgaagatgaagcgctt
gaaattgcaaatgatacgctttacggattaggctcaggcgtatggtcacgtaatggtaat
cgtgcatttagaatgggcaaaggtattcaagcaggtcgtgtgtggactaactgctaccat
gcttatcctgcacatgcggcatttggtggatacaaacaatcaggtatcggtcgcgaaaca
cacaagatgatgctcgatcactaccaacaaactaagaatcttttagtgagctacagtgaa
aataaacttggcttcttttaa

DBGET integrated database retrieval system