KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3493cHelp
Entry
BCG_3493c         CDS       T00463                                 

Gene name
alr
Definition
(GenBank) Probable alanine racemase alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00473  D-Alanine metabolism
mbb01100  Metabolic pathways
mbb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCG_3493c (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BCG_3493c (alr)
Enzymes [BR:mbb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCG_3493c (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mbb01011]
 Precursor biosynthesis
  Racemase
   BCG_3493c (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CAL73482
UniProt: A0A0H3MET3
LinkDB All DBs
Position
complement(3826696..3827922)
Genome map
AA seq 408 aa AA seqDB search
MKRFWENVGKPNDTTDGRGTTSLAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQ
LMAVVKADGYGHGATRVAQTALGAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALLADVQVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALR
QAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT
MARPDLTFDLVRPGIAVYGLSPVPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWI
APRDTNLALLPIGYADGVFRSLGGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEG
DEAILFGPGIRGEPTAQDWADLVGTIHYEVVTSPRGRITRTYREAENR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggttctgggagaatgtcggaaagccaaacgacacgacagatgggcggggcacg
acttcgttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtg
gatctgggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcag
ctgatggcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaacc
gccctgggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctg
cgcgctgatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttc
gggcccgcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaa
ctgttgcacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggatacc
gggctgaaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgc
caagccatggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgcc
gacaagcctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcg
caggcccgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaact
atggcgcgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggcta
agcccggtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgct
gttgcgctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatc
gcgccacgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccgg
tcgctgggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcgg
atctgcatggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggc
gacgaggcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggcc
gatcttgtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccagg
acctatcgcgaggctgaaaaccgttga

DBGET integrated database retrieval system