KEGG   Melittangium boletus: MEBOL_000467
Entry
MEBOL_000467      CDS       T05066                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mbd  Melittangium boletus
Pathway
mbd00480  Glutathione metabolism
mbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MEBOL_000467
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbd02000]
    MEBOL_000467
Enzymes [BR:mbd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MEBOL_000467
Transporters [BR:mbd02000]
 Other transporters
  Pores ion channels [TC:1]
   MEBOL_000467
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6
Other DBs
NCBI-ProteinID: ATB27032
UniProt: A0A250I7A3
LinkDB
Position
566197..566805
AA seq 202 aa
MKLYYTPGACSLSPHIALFEAGQTFDIEKVDLRTKKTESGKDYTTINPKGYVPALQLDDG
TVLTEGPAIVQFIADKAPQAKLAPANGTLERYRLQETLNFIGTELHKPFGSLFNPALPEE
AKTMARNQLANRLKSVNETFGKQPYFQGEQYSVADAYLFTVLSWAPHTGVDLSPYTHLKA
FQERVGARPQVQAALKAEGLLK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaagctctactacacccctggcgcctgttcgctctcgccccacatcgccctgttcgag
gcggggcagaccttcgacatcgagaaggtggacctgcgcaccaagaagactgagtccggc
aaggactacaccaccatcaaccccaagggctatgtgccggccctgcagctcgatgatgga
acggtgctcaccgagggcccggcgatcgtgcagttcatcgccgacaaggcgccccaggcc
aagctcgcgccggccaacggcaccctcgagcgctaccgcctccaggagacgctcaacttc
atcggcaccgagctgcacaagccgttcggctcgctcttcaatcccgccctgccggaggag
gcgaagacgatggcgcgcaaccagctggccaaccgcctcaagtccgtgaacgagacgttc
ggcaagcagccctacttccagggcgagcagtactccgtcgccgacgcctacctcttcacg
gtgctcagctgggcgccgcacacgggcgttgacctgagcccgtacacccacctcaaggcc
ttccaggagcgcgtgggtgcgcgtccgcaggtgcaggcggccctcaaggccgaaggtctg
ctgaagtaa

DBGET integrated database retrieval system