KEGG   Melittangium boletus: MEBOL_001640Help
Entry
MEBOL_001640      CDS       T05066                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mbd  Melittangium boletus
Pathway
mbd00473  D-Alanine metabolism
mbd00550  Peptidoglycan biosynthesis
mbd01100  Metabolic pathways
mbd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MEBOL_001640
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MEBOL_001640
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MEBOL_001640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbd01011]
    MEBOL_001640
Enzymes [BR:mbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MEBOL_001640
Peptidoglycan biosynthesis and degradation proteins [BR:mbd01011]
 Precursor biosynthesis
  Amino acid ligase
   MEBOL_001640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATB28194
UniProt: A0A250I8K4
LinkDB All DBs
Position
1953038..1954162
Genome map
AA seq 374 aa AA seqDB search
MHIAILYNRDHEQLEDDPGREARADVTRVASALAEALAQEGTRVDPVAVEGSRLEFVDVL
ARLRPDLVINLCESVAADSRAETVVPCLLDMLGLPYTGSSALTLGLALHKDKAKELLRAR
GVPTPGFARVDRLEDLEGLELPFPLIVKPAREDASMGITRDSVVHDPAALRQAVALVLKT
FHQPAIVEQFIPGREIYVPLLGNTPRQALPLTEIRFGRLFDDRPNIVTYSGKWETGSPEY
TNTPSAPCLLEDATLEARLVKTAMEAFSALDGQDYGRVDLRVTPEGMPYVIDINPNCDLH
PEAGFAKAALSAGMDYRALARKLVEVALERTHGHPTPRRKGSGVARLPDPSNRNVLHGGK
GLRGRTRRSRAAAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgccattctgtacaaccgagaccatgagcagttggaggacgacccgggtcgg
gaggcgcgagcagacgtgacgcgcgtggcgtccgccctggcggaggccctggcccaggag
ggaacccgggtcgacccggtcgccgtggagggctcccggctggagttcgtggacgtgctc
gcccgcctgcggcccgacctggtcatcaacctctgtgagtccgtggcggcggacagccgg
gcggaaacagtcgtgccctgtctgctggacatgctcgggctgccctacacgggctcctcg
gccctgacgctggggctggcgctgcacaaggacaaggccaaggaactgctcagggcccgg
ggcgtgcccacgccgggcttcgcgcgggtggaccggctcgaggacctcgaggggctggag
ctgcccttcccgctcatcgtcaagcccgcgcgcgaggatgccagcatgggcatcacccgc
gactccgtggtgcacgacccggccgccctgcgccaggcggtggccttggtcctcaaaacc
ttccaccagcccgccatcgtcgagcagttcattcctggacgcgaaatctacgtgcccctg
ctgggcaacacgccccgccaggccctgccgctcacggagatccgcttcggccggctcttc
gacgaccggcccaacatcgtcacctactcgggcaagtgggagacgggctctcccgaatac
acgaacacaccctcggcgccctgcctcctggaagacgcgacgctggaggcccggctcgtg
aagacggcgatggaggccttctcggcgctcgacggccaggactacggacgcgtggacctc
cgggtgacccccgagggcatgccctacgtcatcgacatcaaccccaactgtgatctccac
cccgaggcgggtttcgccaaggccgctctctcggcggggatggactaccgcgccctggcc
aggaaactggtggaggtcgcgctggagagaacccatggacatccgacccctcgaaggaaa
ggatcgggagttgctcgcctccctgatccgtcgaatcgaaacgttctccacggaggaaaa
ggactgcgcggtcgaactcgtcgatctcgcgctgcagccgaataa

DBGET integrated database retrieval system