KEGG   Melittangium boletus: MEBOL_002392Help
Entry
MEBOL_002392      CDS       T05066                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
mbd  Melittangium boletus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ATB28943
UniProt: A0A250ICJ1
LinkDB All DBs
Position
complement(2911065..2912819)
Genome map
AA seq 584 aa AA seqDB search
MKGPALPRVKFPTLHEALEAAARSPLGLVFVDAAERETRVPWAQVHARARRTAAGLRRLG
VKPGDRVALLLPTSPGFMDAFFGTLLAGAVPVPLYPPVRLGRLEEYHRSTARMLEMSGAA
LVLTDAKVRLLLGAPVAAARPRLGCHTVDEASRETGDVAYPATAQALALIQFSSGSTVDP
KPVALRHDNLMAQLAALEAEIPPPEDRAPVGVSWLPLYHDMGLIGCLLSALYYPGDMVLI
PPEVFLARPALWLRALSRHRGFVSPAPNFAYGLCLKRVKDAEMEGVDLSGWRHALNGAEP
VSLETLRRFSERFARWGFQAGAMRPVYGLSEASLAVTFPVAGRGPHALGVDGRVLATERR
AVEGSREVVSVGRPVPGFEVQVRDVLGHELPERQVGRVFARGPSIMEGYFGHPEATVRAL
DEAGWLDTGDLGFEADGELFLTGRAKDLVIIRGANHAPQEFEESLEGVDGLRPGCAVALG
FTPEGEQDEVLLILAEHAPGASGDGLEERVREAVVEATGVRPHTVRILEPGTLPRTSSGK
LRRSEALRRFLADELTAPKKVRAVGLVVEMARSALAFARAGREE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacccgcgctgccccgggtgaagtttcccaccctgcacgaggcgctggaggcc
gcggcgcgctccccgctcgggctcgtcttcgtggacgcggccgagcgcgagacgcgcgtg
ccctgggcgcaggtccacgcgcgcgcccgccgcaccgccgcgggcctgcgccgcctgggc
gtgaagccaggagaccgcgtggcgctcctgttgcccacctcgccgggcttcatggatgcc
tttttcggcacgctcctggcgggcgcggtgccggtgccgctctatccacctgtccgcctg
ggccggttggaggagtaccaccgctccacggcgcgcatgctggagatgtcgggcgcggcg
ctggtgctcaccgatgcgaaggtgcggctgctcctgggggcgcccgtggcggcggcgcgc
ccgaggctcggctgccacacggtggacgaggcgtctcgcgagacgggggacgtggcatac
cccgccacggcccaggcgctcgccctcatccagttctcctcgggctccacggtggacccc
aagcccgtggcgctgcggcacgacaacctgatggcgcaactcgcggcgctggaggcggag
attccgcctccggaggatcgggcgccggtgggcgtgtcgtggctgccgctctaccacgac
atgggcctcatcggctgtctgctctcggcgctgtactacccgggcgacatggtgctcatc
ccgcccgaggtcttcctcgcgaggcccgcgctgtggttgcgcgccctgtcgcgccaccgc
ggcttcgtgtccccggcgcccaacttcgcctatgggctgtgtctcaagcgggtgaaggac
gcggaaatggagggcgtggatctgtcgggctggcggcacgcgctcaatggggccgagccc
gtgtcgctcgagacgctgcgccgcttctccgagcgcttcgcgcgctggggcttccaggct
ggggcgatgcgcccggtgtacggcctgagcgaggcctccctcgccgtcaccttccccgtg
gcggggcggggcccccatgcgctgggagtggatggccgggtgctggccaccgagcggcgc
gcggtggagggctcgcgcgaggtggtgtccgtggggcggccggtgccgggcttcgaggtc
caggtgcgcgacgtgctgggccatgaattgcccgagcgccaggtggggcgggtgttcgcc
cgcggcccctccatcatggagggctacttcggccaccccgaggccaccgtgcgcgcgctg
gacgaggcggggtggctcgacacgggggacctgggcttcgaggcggacggcgagttgttc
ctcaccggccgcgcgaaggatctggtcatcatccggggcgccaatcacgcgccccaggag
ttcgaggagtcgctggagggcgtggacggcctgcgcccgggttgcgcggtggcgctgggc
ttcacgcccgagggcgagcaggacgaggtgttgctgatcctcgccgagcacgcaccgggg
gcctccggggatggcctggaggagcgggtgcgtgaagcggtggtggaggccacgggcgtg
cggccccacaccgtgcgcatcctggagccgggcaccctgccgcgcacctcgagcggcaag
ctgcgccggagtgaggccttgcggcgcttcctcgcggacgaactcacggcgcccaagaag
gtccgggcggtggggctggtggtggagatggccaggagcgcgctggccttcgcccgggcc
ggccgcgaggagtaa

DBGET integrated database retrieval system