KEGG   Melittangium boletus: MEBOL_003167Help
Entry
MEBOL_003167      CDS       T05066                                 

Definition
(GenBank) apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MEBOL_003167
Enzymes [BR:mbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     MEBOL_003167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ATB29712
UniProt: A0A250IEX1
LinkDB All DBs
Position
3778080..3779666
Genome map
AA seq 528 aa AA seqDB search
MSGHPEEGARRLPTFVPWLALGVGAGLLMLLNTEWAVLPGWLMGALFLFFSRRRRPAVGF
VGLLVANTVAAGVANLGVFPGSAANAFGMALGGAVVVAGVYLADRLIVGPRGSFAGTLFL
PAAMTGLELFSSMGNPFGTWGVLAYTQAQVPVLVQLVSVTGLWGLTFVLVWFATVANWAF
EHREAGRRVLPGVAVYAGVLVAILGFGALRLAGAGSVGEPVRVAGITVAGEVATGREAGL
SRLMQGEAFGDEDWRAFAEASRAVNEELLRLSEREAAKGAKLLLWSEGNAVVLAGELDAL
IARGSALARERGVWLGMSVASFTPSVERMLRNELILVGPDGAVAWRYVKSRPVPGWEAEH
SIAGSTEPAVGQAPGVGVLGGAICFDGDFPEVFASASERGLELLLLPSSDWKGISPLHTR
QAVFRAVERGFSMVRQVNQGLSVAVDGYGRVYGELDHFTAEERVLRAELPVGRVPTLYAR
IGDSVGLLSGLVALGWVLQASVRGLVARRRRAVKAAPMEDKGQLSFID
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtcatccggaagaaggagcgcggcgtctgcccacgttcgtgccgtggctcgcc
ctgggcgtgggggccggactgttgatgttgctgaacacggagtgggccgtgctgcccggc
tggctgatgggcgccctgttcctcttcttctcccggcggcggcgtcccgcggtgggcttc
gtggggctcctggtggccaacaccgtcgccgccggcgtggcgaacctgggggtgttcccg
ggctccgccgcgaacgccttcggcatggccttggggggcgcggtggtcgtcgcgggggtg
tatctggcggatcggctcatcgtggggccgcggggctccttcgcggggacgctcttcctg
ccggcggcgatgacggggttggagttgttcagcagcatgggcaacccgttcggcacctgg
ggcgtgctggcctacacccaggcccaggtaccggtgctggtgcagctcgtgtcggtgacg
gggttgtggggcctgacgttcgtcctggtgtggttcgccaccgtggccaactgggcgttc
gagcaccgggaggcggggcgccgcgtcctgcccggggtggcggtgtacgcgggggtgttg
gtggccatcctcggcttcggcgcgctgcggctcgcgggggcggggagcgtgggcgagccc
gtccgggtggcgggcatcaccgtggcgggagaggtggccacgggccgcgaggcggggctg
tcccggctcatgcagggcgaggcctttggcgatgaggactggcgcgcattcgccgaggcc
tcgcgcgcggtgaacgaggagctgctgcgcctgtcggagcgggaggccgcgaagggggcg
aagctcctgctctggtccgaggggaacgcggtggtgctggccggggagctggatgcgctc
atcgcgcgggggagcgcgctggcgcgcgagcgaggcgtgtggctcggcatgtcggtggcg
agcttcacgccttcggtggagcggatgctgcgcaacgagctcatcctggtggggccggac
ggcgcggtggcgtggcgctacgtgaagtcccggccggtgccgggttgggaggcggagcac
tccatcgcgggcagcacggagccggcggtgggccaggcccccggcgtgggagtcctgggg
ggcgccatctgcttcgacggagacttcccggaggtgttcgccagcgcctcggagcgaggg
ctcgagctgctcctgctgccgtcgagcgactggaagggtatcagcccgctgcacacacgg
caggcggtgttccgcgcggtggagcggggcttcagcatggtgcggcaggtcaaccagggg
ctctcggtggcggtggacggctacgggcgcgtgtatggcgagctggaccatttcacggcg
gaggagcgggtgctgcgcgcggagctgccggtggggcgggtgcccacgctctatgcacgc
attggggactcggtgggtctgctctccgggctggtcgcgctgggatgggtgctccaggcc
tccgtccgcgggctcgtcgcgcggcggcgacgcgccgtcaaggccgcccccatggaggac
aagggtcaactgtctttcattgactga

DBGET integrated database retrieval system