KEGG   Melittangium boletus: MEBOL_004356Help
Entry
MEBOL_004356      CDS       T05066                                 

Definition
(GenBank) hypothetical protein
Organism
mbd  Melittangium boletus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding PP-binding
Motif
Other DBs
NCBI-ProteinID: ATB30894
UniProt: A0A250IGD0
LinkDB All DBs
Position
complement(5211982..5216367)
Genome map
AA seq 1461 aa AA seqDB search
MKSPTVVRRETGSTWVELLRGRALEQPARRVFTLLEDGETETRHWDFAELDRRARAIAAT
LQRQTRAGERALLLYPFGLDFVAAFFGALYAGVVAVPVYPPDPSRLNRTLPRLRAIAQDA
QATRVLTTHVIREWVDTLASQAPELASLHWVATDALGPGVEADWRPPDVTPGSLAFLQYT
SGSTSLPKGVRLTHSHLLHNQLVMQRALGTTEQSVGVSWLPMYHDMGLIGCVMHAVYAGF
SMVLLPPESFLRRPSRWPRAISRYRATISGGPNFAFDLCTRKVTPEEAAGLDLSCWHQAF
NAAEPVRPDTLERFARAFAPQGFRAEAFHPLYGLAEATLMTTGKRAEGGPRVLTVEGAAL
ETGHVVERPEGRTGTRRVVGLGHAGSELRVAIVDPITRVRQAPERTGEIWVSGPSVAQGY
WNRPEESEHTFRAVCADTGEGPWLRTGDIGFLREGELFFSGRLKDLVIIRGRNHAPQDIE
RTVEDSHPALRPGCGAAFALDSGSEERLVVVQEVQREREHEDLDSLTHAVRRAVAEAHGL
HLDTLVLVRAGSIPKTSSGKIQRHACRQDFLAQTLDVLHTARPAPRDSTAFLREHLARLL
GTAPEAVDPSRSLAELGLDSMQQLELRQLLENHARAPQAPKPAASGAFSIAWDVAREAPA
LWRHLGEAEPWVAEALERLRRELPVPPTNGTFDTGEHFRPPGHFRAFYRRGPGESVIALK
GTEVRCEDQAGFLQLMQQRLFERHAKHSVTNTLEYFLLQERKVPGALTLPEALTEARRAA
EVQGRFLEEYGAPGGLPVPLLVVRWSEDVAARFRARLLPLLSGFTLGIAEGELREGLACY
VYWFPQAPFPRVSHFAGTLAQESQRTGSGGFTNTRLIYATLKHNLDPGAVVDSWVRLTAR
LLLLGYFPSDIQHFKNGQCIEPQNVLLNGTFADLDSVLPMRQVATDREFYANFLAMLNLL
AHTVRVFLAAEGNGTTTRPAPFPHQFQGPDFLDMLSVLHIWERLLVHLREERPHAHLTLD
PRLEAIVSSRLSFPVLFEKVLFPLYYAGPTLPESAVHLMNVTDVYSDAAPERRRASREVK
YSAKLSVDAVALATLPRAFLDQLQLTPREFIRDCLRDEATLVTVYETFLGRIGLVVLPLE
DAELYVDRQRTVGGVIRGLEEAARLGADTVSLTGLVPSATDYGRALEEATRGREGLPRFT
TGHATTAACFVMMVERVLGAGGRRMEEEHVTLLGAGSIGTAILRLLLRTLPPPSSLRLCD
VPARREHLVRLLEELSLEPGYRGPVEVTLVSGDSVPDEVYASSLVLSATNVPHLLDVNRL
RPGTLVVDDSAPHCFEPRRAIRRFQEKRDVLFSEAGALRSHRPVGEIRELTFATGWDQRI
RAALKLLHPTEDTLMGCVFSSILSSRFTDAPCLVGTPTLRDLELHYRKLRELRLEAARPY
VEDYLLDEDLVGMFRARFGTG
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccccgaccgtggtccggcgtgaaaccggttcaacgtgggtggaactcctccga
ggcagggcgctcgaacagcccgcccgccgcgtcttcaccctcctggaagacggagagacg
gaaacgcggcactgggacttcgcggagctggaccggcgggcccgcgccatcgccgccacc
ctgcaacggcagacccgggccggcgagcgggccctgctgctctaccccttcggcctggac
ttcgtcgccgccttcttcggcgcgctgtacgcgggcgtcgtggccgtgccggtgtatccg
ccggatccctcgcgcctgaaccggaccctgccgcggctgcgcgccatcgcccaggacgcc
caggccacccgggtgctcaccacccacgtcatccgcgagtgggtggacaccctggccagt
caggcaccggagctcgcgtccctgcactgggtggccaccgacgcgctggggcccggagtg
gaggcggattggcggcccccggacgtgacgcccggctcgctcgccttcctccaatacacc
tcgggctccacctcgctgcccaagggcgtgcggctcacccactcccacctgctgcacaac
cagctcgtcatgcaacgcgccctcggcaccacggagcagagcgtgggcgtgagctggctg
cccatgtaccacgacatgggactcatcggctgtgtgatgcatgccgtgtacgcgggcttc
tccatggtgctcctgcccccggagagcttcctgcggcggccctcgcgctggccacgcgcc
atctcccgctaccgcgccaccatcagtggagggcccaacttcgccttcgacctgtgcacc
cggaaggtgacgcccgaggaggcggcggggctcgacctgagctgctggcaccaggccttc
aacgccgccgagcccgtgcgtcccgacaccctggagcgcttcgctcgcgcgttcgcgccc
cagggcttccgcgccgaggcgttccatcccctctacggcctcgccgaggccacgctcatg
acgacggggaagcgcgcggagggagggccgagggtgctcaccgtggagggcgcggcgctg
gagaccggccacgtcgtcgagcggcccgaggggcggaccggcacccggcgcgtggtgggc
ctgggacacgcgggcagcgagctgcgcgtggccatcgtggaccccatcacccgcgtgcgc
caggccccggagcggacgggggaaatctgggtgtcgggccccagcgtggcccagggctac
tggaaccggccggaggagagcgagcacaccttccgcgctgtgtgcgccgataccggcgag
ggcccctggctgcgcaccggagacatcggcttcctgcgcgagggcgagctgttcttctcc
ggcaggctcaaggatctggtcatcatccggggccgcaaccacgcgccccaggacatcgag
cgcaccgtcgaggacagccaccccgccctgcgccccggctgtggcgccgccttcgcgctg
gactcggggagcgaggaacggctcgtcgtcgtccaggaagtccaacgcgagcgggagcac
gaggacctggactccctcacccacgccgtgcggcgcgcggtggccgaggcccatggcctg
cacctcgacacgctcgtgctcgtgcgcgcgggctccattcccaagacgtccagcggcaag
attcaacgccacgcctgccgccaggacttcctcgcccagacgctggacgtcctgcacacc
gcgcggcccgcgcctcgggactccaccgccttcctgcgcgaacacctggcgcggctgctc
ggtaccgcccccgaggcggtggatccctcgcgctccctggcggagctcggcctggactcg
atgcaacagctggagctgcgccagctcctggagaaccatgcccgtgcgccccaggcgccg
aagcccgccgcgtccggcgccttctccatcgcctgggacgtggcgcgcgaggcccccgcg
ctctggcgccacctcggcgaggccgagccctgggtggccgaggccctggagcggctgagg
cgggagctgcccgtgcctcccaccaacggcaccttcgacaccggcgagcacttccggcct
ccgggtcacttccgcgccttctaccggcgcggccccggcgagagcgtgatcgccctcaag
ggcaccgaggtgcgctgcgaggaccaggcgggattcctccagctcatgcaacagcggctc
ttcgagcgccatgcgaagcactcggtgacgaacacgctggagtacttcctgttgcaggag
cgcaaggtgcccggcgcgctcacgctgcccgaggcgctcaccgaggcgcggcgcgcggcc
gaggtccagggccgcttcctggaggagtacggcgctccgggcggactgcccgtgccgctg
ctggtggtgcgctggagcgaggacgtggcggcgcgcttccgggcccggctcctgcccctg
ctctccggcttcacgctgggcatcgccgagggcgagctgcgcgaggggctcgcctgctac
gtgtactggttcccccaggcgcccttcccccgggtgagccacttcgccggcacgctcgcc
caggaaagccagcgcacgggctcgggggggttcaccaacacgcgcctcatctacgccacg
ctcaagcacaacctggaccccggcgccgtggtcgactcctgggtgcggctcaccgcgcgc
ctgctgctgctcggctacttcccgagcgacatccagcacttcaagaatggccagtgcatc
gagccgcagaacgtcctgctcaacggcaccttcgcggacctggactcggtgctccccatg
cgccaggtggccacggatcgggagttctacgcgaacttcctcgccatgctgaacctgctg
gcccacaccgtgcgcgtcttcctggcggccgagggcaacggcaccaccacgcggcccgcg
ccctttccgcaccagttccagggccccgacttcctggacatgctctccgtgctgcacatc
tgggagcggctgctcgtgcacctgcgcgaggagcggccccacgcgcacctgacgttggat
ccccggctggaagcgatcgtctcctcgcggctgtccttcccggtgctcttcgagaaggtg
ctcttcccgctctactacgccgggcccacgctgcccgagagcgccgtgcacctcatgaac
gtgacggacgtctacagcgacgcggccccggagcggcggcgcgcctcgcgcgaggtgaag
tacagcgcgaagctgtccgtggacgccgtggcgctggccaccctgccgcgcgccttcctg
gaccagctccagctcaccccgcgcgagttcatccgcgactgcctgcgcgacgaggccacg
ctcgtcaccgtgtacgagacgttcctcggccgcatcgggctggtggtgctgcccctggag
gacgcggagctctacgtggaccggcaacgcaccgtggggggcgtcatccgggggttggag
gaagcggcccggctgggagccgacacggtgtccctcacggggctggtgccctcggccacg
gactacgggcgcgccctcgaggaggccacgcgcggccgggagggactgccccgcttcacc
accggccacgccaccaccgccgcctgcttcgtgatgatggtggagcgggtgctcggcgcg
ggcgggcgccgcatggaggaggagcacgtgacgctgctgggcgcgggctccatcggcacc
gccatcctccgcctgctgctgcgcaccctgcccccgccaagctcgctgcggctgtgcgac
gtgcccgcccggcgggagcacctggtgcggctcctcgaggagctgagcctggagccgggc
taccgcggcccggtggaggtgacgctcgtctccggcgacagcgtgcccgacgaggtgtac
gcctcctcgctggtgctcagcgccacgaacgtgccccacctgctcgacgtgaaccggctg
cggcccggcacgctggtggtggacgactcggcgccccactgcttcgagcctcgccgcgcc
atccgccgcttccaggagaagcgcgacgtgctcttcagcgaggcgggggccctgcgcagc
caccggcccgtgggggaaatccgcgagctcaccttcgccacggggtgggaccagcgcatc
cgcgcggcgctcaagctgctgcaccccaccgaggacaccctcatgggctgtgtcttctcc
agcatcctcagctcgcgcttcacggacgcgccgtgtctggtgggcacgcccacgctccgg
gacctggagctgcactaccgcaagctgcgcgaactgcgcctcgaggccgcccggccctat
gtggaggactacctcctggatgaggacctggtggggatgttccgcgcccgctttggcacc
gggtag

DBGET integrated database retrieval system