KEGG   Melittangium boletus: MEBOL_004568Help
Entry
MEBOL_004568      CDS       T05066                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MEBOL_004568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ATB31106
UniProt: A0A250IJI8
LinkDB All DBs
Position
5480144..5480911
Genome map
AA seq 255 aa AA seqDB search
MDLTPLQIVLLCVAALTAGTVDAIAGGGGLVSLPALLSTGMPPHVALGTNKGQSVFGAFA
ALVRFWRAGLVRGNLASITFPLGLVGSLLGTGLVLLMRPEVLKPVVLALLVVVAVFLAFR
RGPPPGVRPEPPLARMKALGAVIALLIGVYDGFFGPGTGTFLIIAFSGLLGHSLTHASAD
AKVVNFATNLSAVALFSYRGLVLWHVALPMAAAQFTGAWMGAHLAVRGGDKLVRKVVLGV
VVALVLKLGRDVLAG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggacttgactcctctccagattgtcctgttgtgcgtcgcggccctcacggctggcacg
gtggatgccatcgcgggtggaggagggctcgtgtccctgcccgccctcctgtcgacgggc
atgcccccgcacgtggcgctcgggaccaacaagggtcagtccgtgttcggtgcgttcgcc
gcgctggtgcgcttctggcgcgccgggctggtgcgcggcaacctggcctccatcaccttt
cccctgggcctggtgggctcgttgctgggcacgggactggtgctgctcatgcggccggaa
gtcctcaagcccgtggtgctcgcgctgctggtggtggtggccgtcttcctggccttccgc
cggggccctccaccgggggtccggcccgagccgccgctcgcgcgcatgaaggccctgggg
gcggtcatcgcgctcctcatcggcgtctatgacggcttcttcggccccggtacggggacg
ttcctcatcatcgcgttctcgggactgctcgggcactcgctgacgcacgcctcggcggac
gccaaggtggtcaacttcgcgacgaacctgtcggcggtggcgctcttctcctaccggggc
ctggtgctctggcacgtggcgctgcccatggcggcggcccagttcaccggggcctggatg
ggtgctcacctcgccgtgcgcggtggcgacaagctcgtgcgcaaggtggtgctgggcgtg
gtggtggcgctcgtgctcaagctgggccgggacgtgctcgccgggtga

DBGET integrated database retrieval system