KEGG   Melittangium boletus: MEBOL_004626Help
Entry
MEBOL_004626      CDS       T05066                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mbd  Melittangium boletus
Pathway
mbd00473  D-Alanine metabolism
mbd00550  Peptidoglycan biosynthesis
mbd01100  Metabolic pathways
mbd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MEBOL_004626
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MEBOL_004626
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MEBOL_004626
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbd01011]
    MEBOL_004626
Enzymes [BR:mbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MEBOL_004626
Peptidoglycan biosynthesis and degradation proteins [BR:mbd01011]
 Precursor biosynthesis
  Amino acid ligase
   MEBOL_004626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 GARS_A DUF2610
Motif
Other DBs
NCBI-ProteinID: ATB31164
UniProt: A0A250IH64
LinkDB All DBs
Position
5558115..5559149
Genome map
AA seq 344 aa AA seqDB search
MALSPLRVAVLYYQPKEDEADPVVQQVSRSLREAGHTPVPVRVDESLSDLVRQVSRSRAD
LVFNLCETFADDYRLEVNVAAVLELARMPFTGSGTAGLLLAQDKILTKQLLQFHGVLTPR
FATFDGTSLQAHGDLSFPLIVKPARSDASMGLGVEKDMDGLARRVRLIREQYDDEALAEE
FIEGREVYVGVLGDHARPQVLPVVELDFGEKWSRKRMKIADRGVKFGPEGPGEPALVMPK
DLSDELRGRIERSAVAAFRALKLSDYARIDFRVSSATNEPYLLEVNPNPYLEEKCEVAMG
ARETGLSYPQLIQHIVETAARRHGLGRDQRRAAPVADSEPAPMS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtctcccctgcgcgtcgcggtcctctattaccagcccaaggaggacgaggcc
gatcccgtcgtccaacaggtgtcccggtctctccgggaagcgggacacacgcccgtgccc
gtgcgcgtcgacgagagcctgtcggacctggtgcggcaggtgtcgcgcagccgcgcggac
ctcgtcttcaacctgtgcgagaccttcgccgacgactaccggttggaggtgaatgtcgcc
gccgtgctggagctcgcgcgcatgcccttcacgggctcggggacggcgggcctcttgctc
gcgcaggacaagatcctcaccaagcagttgttgcagttccatggtgtgctcacgccgcgg
ttcgccaccttcgatggcacgtcgctgcaggcccacggagacctgtccttcccgctcatc
gtcaagccggcgcgctcggatgcgtccatggggttgggggtggagaaggacatggatggc
ctggcgcgccgggtgcgcttgattcgcgagcagtacgacgacgaggcgctggcggaggag
ttcatcgagggccgcgaggtgtacgtgggcgtgctgggggaccacgcgaggccccaggtg
ctgccggtggtggagctggacttcggcgagaagtggagccgcaagcgcatgaagatcgcg
gaccggggggtgaagttcggccccgagggacccggcgaacccgcgctcgtgatgccgaag
gacctgtcggacgagctgcggggacgcatcgagcgctccgcggtggcggccttccgggcg
ctcaagttgagtgactacgcgcgcatcgacttccgggtgtccagcgccaccaacgaaccg
tacctgctcgaggtcaatccgaatccctaccttgaggagaagtgcgaggtggcgatgggg
gcccgggagacaggcctgtcctatccccagctcatccagcacatcgtcgagacggcggcg
aggcggcacgggctgggccgggaccagcgccgcgccgcgccggtggcggactccgagccc
gcgcccatgagttga

DBGET integrated database retrieval system