KEGG   Melittangium boletus: MEBOL_004870Help
Entry
MEBOL_004870      CDS       T05066                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MEBOL_004870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mbd03400]
    MEBOL_004870
Enzymes [BR:mbd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MEBOL_004870
DNA repair and recombination proteins [BR:mbd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MEBOL_004870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ATB31407
UniProt: A0A250IJS0
LinkDB All DBs
Position
5857250..5859766
Genome map
AA seq 838 aa AA seqDB search
MGTYREKRDFSRTSEPSPEVSAPAGGGVFVVHKHDATRLHYDLRLEIDGVLVSWAIPKGP
SHDPADKRLAVQTEDHPLAYATFEGRISEGNYGAGDSLLWESGTFDTVPPGEASAQLARG
RLHVALHGQKLEGEWHLIRTRPVGKKAQWLCIKAKDGTERPGYDVTVERPESVKSGQRVT
RGPKRRTASKAKAKATPRLRSPQALLARVGTPMLATLAQVEATDAADWRFEVKYDGFRAL
AAVHGGRVALHSRGGHDLSERFPAIAQALEALGKHEVVLDGELVALDAQGRSRFQLLGKG
AEERFVVFDVPWLDGEDLSPLPLEERRKKLEGLLARVKPPLALAERVEGTARQALSQARR
RGWEGVMAKRVGSVYAPGRGEAWLKLKVQANQEVAIVGFTPMANERPEIGALLVAVREDG
AWRYAGKVGTGYSTQVRRDLLKLLSRDEVKKPLVKEAPRVRDALRHEEAVWVKPRHVAQV
AFTEWTEDGRLRHPSFQGLRNDKRPEECVRERPRETPVRRGPSARGPHRETGRKARPGKR
AAGRTATARKGAAGEPVVLTHGERVLFPAVGLTKADVFAWFQDVAPLMVPALAGRPLTLQ
QWPQGIQAPGFFRQGVESAPDWLTVTRIRHEARLLSHVVVDRPESLLWLANQSALTLHMW
SSRVPHLKQPDWVVFDLDPGPKGTFEELIELTLGLRRLLERLGLASVPKTSGKRGLHVLV
PLAPGHTYARTRAFALQVFEALAQEYPELATTEHAKTRREGRLYLDAGQNAWGKTVVAPY
SLRALPHAPVSTPLKWSEVTRRLDPTRFTLETLRRRLDKVGDLFAPALEGGQTLPSSS
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
ttgggcacctaccgcgagaagcgtgacttctcgcggacctccgagccctctccagaggtt
tccgcgcccgccggtgggggcgtcttcgtggtgcacaagcacgacgccacgcggctgcac
tacgacctgcggctggagatcgacggggtgctcgtcagttgggccattcccaagggcccg
agccatgacccggcggacaagcggctcgcggtccagaccgaggaccaccccctggcctat
gccaccttcgagggccgcatctccgaggggaactacggagcgggggattcgctgctgtgg
gagtcgggcaccttcgacaccgtgcctccgggtgaggcctcggcgcagctcgcgcggggc
cggctgcacgtggcgctgcatggccagaagctcgagggcgagtggcacctcatccgcacg
cgtccggtgggcaagaaggcgcagtggttgtgcatcaaggccaaggatggcaccgagcgc
cctggctatgacgtcaccgtcgagcgtcccgagtccgtgaagtccggccagcgtgtcacc
cgcgggcccaagcgccggaccgcgtccaaggccaaggccaaggccacgcccaggctccgc
tcgccccaggccctcctggcgcgggtgggcacgcccatgctggccacgctcgcccaggtg
gaggccacggacgcggcggactggcgtttcgaggtgaagtacgacggcttccgcgcgctc
gcggcggtccacggcggacgggtggccctgcactcgcgcggaggccatgacctgtccgag
cgctttcccgccatcgcccaggccctcgaggcgctggggaaacacgaggtggtgctggac
ggggaactcgtggccctggatgcccagggccgttcgcgcttccaactgctcggcaagggc
gccgaggagcgcttcgtggtgttcgatgtcccgtggctcgacggggaggacctgagcccg
ctgccgctggaggagcgccggaagaagctcgaggggctgctggcgcgggtgaagccaccg
ctcgcgctcgccgagcgggtggaggggaccgcgcggcaggcgctctcccaggcgcggcgg
cgagggtgggagggcgtcatggccaagcgcgtgggctccgtctacgcgccgggccggggc
gaggcatggctcaagctcaaggtccaggccaaccaggaggtggccatcgtgggcttcacg
cccatggccaacgagcggccggagattggcgcgctcctggtggcggtgcgtgaggacggg
gcctggcgttacgcgggcaaggtggggacgggttactccacgcaggtgcggcgcgatctg
ttgaagctcctgtcgcgcgacgaggtgaagaagcccctggtgaaggaagcgccgcgggtc
cgtgacgccttgcgccacgaggaggccgtctgggtgaagccccgccacgtggcccaggtg
gccttcaccgagtggaccgaggacggacgcctgcgccatccctccttccaggggctgcga
aacgacaagcgccccgaggagtgtgtgcgcgagcggccgcgcgagacgcccgtgcgccgg
ggcccctccgcgcgagggccgcaccgggagacgggacgcaaggcgcgtccggggaagcgg
gccgcgggacggaccgccaccgcccggaagggcgccgccggggagccggtcgtgctcacc
catggggagcgggtgctgtttcccgcggtgggactcaccaaggcggacgtgttcgcgtgg
ttccaggacgtggcgcccctgatggtgccggcgctcgcgggccggccgctcacgttgcag
cagtggccccaggggatccaggcgcccggcttcttccgccagggggtggagagcgcgccg
gactggctcaccgtcacgcgcatccggcacgaggcgcggctcttgtcccacgtggtggtg
gacaggcccgagtcgctgctgtggctcgccaaccagtccgcgctcaccctgcacatgtgg
tcgagccgggtgccgcacctcaagcagcccgactgggtggtgttcgatctggatcccggt
cccaaggggaccttcgaggagctgatcgagctgacgctgggcctgcggcgtctgttggag
cggctcggcctggcgagcgtgcccaagacgtccggcaagcggggcctgcacgtgttggtg
cccctggcgccgggccatacctacgcgcggacaagggcgttcgcactccaggtgttcgaa
gcgctcgcccaggaatacccggagttggccaccaccgagcacgccaagacgcggcgtgaa
gggcggctgtacctggacgcgggccagaacgcctggggcaagacggtggtggcgccctac
tcactccgggcgctgccgcacgcgcccgtgtccacgccgctcaagtggtcggaggtgacg
cgccggttggaccccacacggttcaccctcgagaccctgcggcggcgcctggacaaggta
ggcgacctgttcgcccccgccctggagggagggcagacgctcccgtcttcctcttga

DBGET integrated database retrieval system