KEGG   Melittangium boletus: MEBOL_005242Help
Entry
MEBOL_005242      CDS       T05066                                 

Definition
(GenBank) fatty acid-binding protein
  KO
K09136  ribosomal protein S12 methylthiotransferase accessory factor
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mbd03009]
    MEBOL_005242
Ribosome biogenesis [BR:mbd03009]
 Prokaryotic type
  ribosomal protein modification factors
   MEBOL_005242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YcaO HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ATB31773
UniProt: A0A250IKM3
LinkDB All DBs
Position
6308342..6309508
Genome map
AA seq 388 aa AA seqDB search
MSLPPAPPLTPDFLARLAPALGVTRVARVTGLDRAGVEVAVAVRPGGYVLQVCNGKGLDF
PAASAGALLETAELWAAETVPAEALLWGSLEGWLSRGRAAWGAEALGTRGGVAFPRLWSS
RVRCAWREATELHSGQPVLVPAQGVYCPPTGAPALGPVCVQWTSNGSGAHPERPRALLHA
LLEATERDQLARLLPEGWTEDVLRSRLLRPEGLEKGAPRTAALARTLGPRGFDVHLFDLS
PGAKTSGAVGLPVGGALLVDRDQGPVPLAAGYACALTRDQALLGALLEAAQSRLTDIHGA
REDVEPGDVEASLALAAACAEMRPRRDVASMPEPPVSLSSPEDAVREVLRRLAEAGFPRA
AAVDLEAPLPGLHVVRVVVPGLRVSELL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgccccccgcgcctcccctgacgcctgacttcctcgcgcggctcgccccggcg
ctcggcgtcacccgggtggcgcgcgtgacggggctggatcgggcgggcgtggaggtggcc
gtcgcggtgcggccggggggttatgtgctccaggtctgcaatggcaagggcctggatttc
ccagcggcctcggcgggcgccctcctggagacggcggagctgtgggcggcggagaccgtg
cccgcggaggctctactctggggctcgctggaggggtggctgtcgcgggggcgtgccgcc
tggggggccgaggccctgggcacgcgaggcggggtggccttcccgcgtctctggagctcc
cgggtgcgttgcgcctggcgcgaggccaccgagctgcactccggccagcccgtgctcgtt
ccggcccagggcgtgtactgcccgcccacgggagcgcccgcgctcggtccggtgtgtgtg
cagtggacgagcaatggctcgggtgcgcaccccgagcggccccgggcgctgctgcacgcg
ttgctggaggcgaccgagcgggatcaactcgcgcgcctgttgccggaggggtggacggag
gatgtgcttcgctcccggttgctgcgccccgaggggctggagaagggcgcgccgcgcacg
gccgcgctcgcgcggacgctcgggccccggggcttcgacgtgcacctcttcgatctctcc
cccggcgcgaagacatccggcgcggtgggccttccggtgggcggggcgctgctggtggat
cgcgaccaggggccggttcccctggcggcgggttacgcgtgcgcgttgacgcgggatcag
gccctgctcggcgcgctgctggaggcggcccagtcccgcctcaccgacatccacggcgcg
cgcgaggacgtggagccgggggacgtggaggcctccctggccctggccgccgcgtgcgcg
gagatgcgtccgcgccgggacgtggcctccatgcccgagcctcccgtgtccctgtcctcg
cccgaggacgccgtgcgcgaggtgctgcgccggctggcggaggcgggcttcccgcgcgcc
gccgccgtggacctggaggctcctctccccggactgcacgtggtgcgcgtggtggtgccg
ggcctgcgtgtgtcggagttgctgtga

DBGET integrated database retrieval system