KEGG   Melittangium boletus: MEBOL_005846Help
Entry
MEBOL_005846      CDS       T05066                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MEBOL_005846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE MarC TerC DUF1422
Motif
Other DBs
NCBI-ProteinID: ATB32369
UniProt: A0A250IKR4
LinkDB All DBs
Position
7048617..7049384
Genome map
AA seq 255 aa AA seqDB search
MTLLFLIAAGVLSGTLGALLGVGGGVILVPTLVLGFQVPLEDAVPASLMCVVASSCGASA
SYLERRLSDVRLGLTLELATVTGAIVGGLVATLVAPAWVALVFGLFALYVSAQMLLARGG
REQRLEDYTPTNYPLGISGSFVAGSLSALLGVGGGPLKVPLMTYGMRVPFKVASATSNLM
IGVTGAASVAAYAWRGHVKLALVAPLVVGVLAGASVGSRLMPRVPTGVLRRLFAGVLLMV
AAQMLWKGAEGLWPK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttctcttcttgatcgccgcgggtgtcctctcggggacgttgggtgccctcctc
ggggtggggggaggggtcatcctggtgcctaccctggtgcttggcttccaggtgccattg
gaggacgccgtccccgcgagcctcatgtgcgtggtggcgagctcctgcggcgcgtcggcc
agctatctggagcggcggctgagtgatgtgcgcctgggtctgaccctggagctggccacg
gtgacgggcgccatcgtgggcggactggtggcgaccctggtggcgccggcctgggtcgcg
ctcgtcttcgggctcttcgccctctacgtgtcggcgcagatgctgctcgcacggggaggc
cgggagcagcggctcgaggactacacacccaccaattaccccctgggcatctccggctcc
ttcgtggcgggcagcctgtcggcgctgctgggcgtgggcggtggccccctcaaggtgccg
ttgatgacctacggcatgcgggtgcccttcaaggtggccagcgccacgagcaatctgatg
atcggcgtgacgggcgcggcgagcgtggccgcctatgcgtggcgtggccacgtgaagctc
gcgctggtggcgcccctggtggtgggggtgctggcgggggcctcggtgggcagccggttg
atgccgcgggtgcccacgggggtgttgcgccggctgttcgcgggtgtgctgctgatggtg
gcggcgcagatgttgtggaagggagcggaaggactatggccgaaatag

DBGET integrated database retrieval system