KEGG   Melittangium boletus: MEBOL_006869Help
Entry
MEBOL_006869      CDS       T05066                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mbd  Melittangium boletus
Pathway
mbd00020  Citrate cycle (TCA cycle)
mbd00480  Glutathione metabolism
mbd01100  Metabolic pathways
mbd01110  Biosynthesis of secondary metabolites
mbd01120  Microbial metabolism in diverse environments
mbd01130  Biosynthesis of antibiotics
mbd01200  Carbon metabolism
mbd01210  2-Oxocarboxylic acid metabolism
mbd01230  Biosynthesis of amino acids
Module
mbd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEBOL_006869
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MEBOL_006869
Enzymes [BR:mbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MEBOL_006869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATB33377
UniProt: A0A250IQD1
LinkDB All DBs
Position
8358693..8359988
Genome map
AA seq 431 aa AA seqDB search
MAPPSGEKITLSNGKLSVPNNPIIPYIEGDGTGRDIWRASQNVFDAAVEKAYGGKKKISW
FEVLAGEKAFKTVNNWLPDETVTAFREYLVGIKGPLTTPVGGGIRSLNVALRQMLDLYVC
LRPVRYFKGVPSPVKTPEKVDMVIFRENTEDIYAGIEFEAGTANAAKVLEILKKEFPKDF
AKIRFPQDVGLGIKPVSKEGSERLIRSAIDYALEHKRKSVTFVHKGNIMKFTEGAFRKWG
YELAAREYGDKVYTWDQWEATKAAKNEEAANAEQKAALASGKVLIKDSIADITLQQVLTR
PDEFDVIATLNLNGDYLSDALAAQVGGIGIAPGGNINYLTGHAVFEATHGTAPKYADLDK
VNPGSVILSGEMMLRHLGWNEAADLIIKGMDKAITNKTVTYDFARLMNQEKQAGVTEVKC
SEFGQAIIKNM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcccctccgagcggcgagaagatcaccctgagcaacggcaagctgtccgtgccgaac
aaccccatcatcccctacatcgagggcgacggcaccggccgcgacatctggcgtgcctcg
cagaacgtcttcgacgcggcggtggagaaggcctacggggggaagaagaagatctcctgg
ttcgaggtgctcgccggcgagaaggccttcaagacggtgaacaactggctgccggacgag
accgtcacggcgtttcgtgagtacctggtgggcatcaagggcccgctgaccacgccggtg
ggcggtggcatccgctcgctcaacgtggcgctgcgccagatgctcgacctgtacgtgtgc
ctgcgtcccgtgcgctacttcaagggcgtgcccagccccgtgaagacccccgagaaggtc
gacatggtcatcttccgggagaacaccgaggacatctacgcgggcatcgagttcgaggcg
ggcacggccaacgccgccaaggtgctggagatcctcaagaaggagttccccaaggacttc
gcgaagatccgcttcccgcaggacgtgggtctgggcatcaagcccgtgtcgaaggaaggc
agcgagcgcctcatccgctcggccatcgactacgccctggagcacaagcgcaagagcgtc
accttcgtgcacaagggcaacatcatgaagttcaccgagggcgccttccgcaagtggggc
tacgagctggcggcgcgcgagtacggtgacaaggtctacacgtgggatcagtgggaggcc
accaaggccgccaagaacgaggaggccgccaacgccgagcagaaggcggcgctcgcctcg
ggcaaggtcctcatcaaggactccatcgcggacatcaccctgcagcaggtgctcacgcgt
ccggacgagttcgacgtcatcgccacgctcaacctcaacggtgactacctgtccgacgcg
ctcgccgcgcaggtgggcggcatcggcatcgcgccgggcggcaacatcaactacctcacc
ggccacgccgtgttcgaggccacccacggcaccgcgcccaagtacgcggacctggacaag
gtgaaccccggctcggtcatcctctcgggcgagatgatgctgcgccacctgggctggaac
gaggcggccgacctcatcatcaagggcatggacaaggccatcacgaacaagaccgtcacc
tacgacttcgcgcgcctgatgaaccaggagaagcaggcgggcgtgaccgaggtgaagtgc
tcggagttcggccaggccatcatcaagaacatgtag

DBGET integrated database retrieval system