KEGG   Melittangium boletus: MEBOL_006912Help
Entry
MEBOL_006912      CDS       T05066                                 

Definition
(GenBank) hypothetical protein
Organism
mbd  Melittangium boletus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ATB33417
UniProt: A0A250IQG4
LinkDB All DBs
Position
8410636..8412336
Genome map
AA seq 566 aa AA seqDB search
MSGDLASSFRSAVERAGLQFIVDCPPLSQPVYLDGESWEKIVLNLVSNAFKFTHQGSITV
RTREWEGRALLEVSDTGTGIPAAELPRLFERFHRVKDAHARTHEGSGIGLALVRELVLLH
GGRVRVDSTEGRGTTFTVEVPLGTGHLPEERVRASRGQSSTAVGAGAYVEEALRWTVEES
PAPRVLDPGLPRARVLLADDNADMRDYIHRVLSVEFTVDSVADGQAALEAALAHPPDLVL
SDVMMPRLDGVGLLRALRAAPHTRELPILLLSARAGQEATLEGIESGADDYLVKPFSARE
LLARVRAHLERMRMRRQVAQERVRVDNLLEAVRARDEFLSLASHELKTPLTAFQLQLGAI
ERSVNKASPHDIGERLVSARRSVRRLASLVETLLDVSRLAPGRIQLALEPLDLTALVEEM
VSAHQDEARRQGSTLVAQVEPSLGGFFDRSRMEQVLQHLLSNALKFGRGRPVELSLREEG
PLLELSVVDHGIGIPEVDRHRVFERFERAVPVRHYGGLGLGLWVMRQVIEAHHGSILIQE
TPGGGATFLVRLPRDEREARARSPSN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggggacctggcgagcagcttccgctcggcggtggagcgcgcgggcctccagttc
atcgtggactgtcctcccttgtcccaacccgtctatctggacggcgagtcgtgggagaag
atcgtcctcaacctcgtctccaacgccttcaagttcacccatcagggctccatcacggtg
cggacccgtgagtgggagggccgggccctgctcgaggtgagcgacacgggaacgggcatt
cccgccgcggaactgccgcgcctcttcgagcgcttccaccgggtgaaggacgcgcatgcc
cggacccatgagggctctggcattggcctggcgctggtgcgggagctcgtgctgttgcac
gggggccgcgtgcgggtggacagcacggaggggcgggggacgacgttcaccgtcgaggtg
cctctgggcaccgggcacttgcccgaggagcgcgtccgggcctcgcgcggccagtcctcc
accgcggtgggcgccggcgcctatgtcgaggaggcgctgcggtggacggtggaggaatcg
ccagcgccccgagtgttggacccgggcctgccacgggcgcgggtgctcctcgcggacgac
aacgcggacatgcgcgactacatccaccgggtgctgtccgtcgagttcaccgtggactcg
gtggcggatgggcaggcggccctggaagccgcgctggcccatcctccggacctcgtgctc
tcggacgtgatgatgccgcggctggacggcgtgggcttgttgcgcgccctgcgggcggct
ccccacacccgggagctgcccatcctcctgttgtctgcccgggccggacaggaggccacg
ctcgagggcatcgaatccggagcggatgactacctcgtcaaacccttctccgcgcgtgag
ttgctcgcccgggttcgcgctcacctggagcgcatgcgcatgcgccggcaggtggcccag
gagcgggtgcgcgtggacaacctcctggaggcggtgcgggcgcgggacgagttcctctcc
ctggcctcccatgaattgaagacgccgctcaccgccttccaactccagctcggcgccatc
gagcggagcgtgaacaaggcctcgccccatgacatcggcgagcgtctggtatcggcccgg
cgctccgtgcgccggctggccagcctcgtcgagaccctgttggacgtatcgcggctcgct
cctggccgcatccaactggcgctcgagccgctggacctgacggcgctcgtggaggagatg
gtgtcggcccaccaggacgaggcccggcgccagggctccaccctggtcgcccaggtcgag
ccctccctgggcgggttcttcgaccggagccgcatggagcaggtgctccagcatctgctg
tccaatgccctgaagttcgggcggggccgtccggtggagctatccctgcgcgaggagggg
cctctcctggagctctccgtcgtggaccatggcattggaatccccgaggtcgatcgccac
cgggtcttcgagcggttcgagcgggccgtgccggtgcgccactacggtggcctgggattg
ggactctgggtgatgcggcaggtgatcgaggcccaccatggaagtatcctcattcaggag
acgccaggtgggggggccacgttcctcgtccgcctgccgcgcgacgagcgcgaggcccgc
gcccgctctccctcgaattga

DBGET integrated database retrieval system