KEGG   Melittangium boletus: MEBOL_006925Help
Entry
MEBOL_006925      CDS       T05066                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mbd01002]
    MEBOL_006925
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbd04147]
    MEBOL_006925
   04090 CD molecules [BR:mbd04090]
    MEBOL_006925
Enzymes [BR:mbd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     MEBOL_006925
Peptidases [BR:mbd01002]
 Metallo Peptidases
  Family M2
   MEBOL_006925
Exosome [BR:mbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MEBOL_006925
CD molecules [BR:mbd04090]
 Proteins
  MEBOL_006925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATB33430
UniProt: A0A250IQB2
LinkDB All DBs
Position
8429031..8430923
Genome map
AA seq 630 aa AA seqDB search
MKHTPFVPRFLRAALAAVPLLAASSGCATSAPAANPSPEAPSAAAPKAAQAPLTAADARQ
FTSRVNDELKQLWTRQATAEWIKATYITDDTERNAASVNEEVMAYLNRAITEAARFKDVQ
GLDADSARMLHLLRVTSPLPAPNSPDKRAELAAIAAKLEGLYGKGKYCGPEGKGACKDLG
ELSDIMAKSRDYNTLLDAWMGWHSISPPMRPLYERMVELSNEGAREIGFQDTGALWRSGY
DMPPEAFEKEAQRLWGQVKPLYDDLHCYVRARLAKQYGEDKVPAGKPIPAHLLGNMWAQE
WNNISNLVEPYQGQPSLDVSAEIQSQKYDAVRMVKLGEGFFTSLGLKALPETFWQRSQFT
KPRDREVVCHASAWDITYDNDLRVKMCIKPTEEDLVTIHHELGHDYYYTYYYKLPVLYQQ
GANDGFHEAIGDAITLSITPSYLKQVGLLKKVPEGDKGLINLQMKDAMEKVAFLPFGLLV
DQWRWEVLSGRVKPADYNASWWALREKYQGVRAPVERSEKDFDAGAKYHVPANVPYTRYF
LARILQFQFHRALCQAAGHKGPLHECSIYGNKDAGKRLQAMLELGASKPWPDALEALTGE
RQMDASAILEYFTPLRAWLQTQNKGQKCGW
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacactcccttcgttccccgcttcctgcgcgcggccctcgcggccgtgccgctc
ctcgcggcctcttccggctgcgcgacctcggcccccgccgccaacccgtctcccgaggcg
ccgagcgccgcggcgcccaaggccgcccaggctccgctcaccgccgcggacgcgcgccag
ttcacctcccgtgtgaatgacgagctcaagcagttgtggacgaggcaggccacggccgag
tggatcaaggccacctacatcaccgatgacacggagcggaacgcggccagcgtcaacgag
gaggtgatggcctacctcaaccgggccatcaccgaggcggcgcgcttcaaggacgtccag
gggctcgacgcggactccgcgcgcatgctgcacctgctgcgggtgacgtcaccgcttccc
gcgccgaactcgcccgacaagcgcgcggagctggcggccatcgccgccaagctcgagggt
ctctacggcaagggcaagtactgcggcccggagggcaagggcgcctgcaaggacctgggc
gagctgtccgacatcatggccaagagccgcgactacaacacgctgctcgacgcgtggatg
ggctggcactccatctccccgcccatgcgtccgctctacgagcgcatggtggagctgtcc
aacgagggcgcccgggagattggcttccaggacacgggtgcgctctggcgctcgggctat
gacatgccgcccgaggccttcgagaaggaagcccagcggctgtgggggcaggtcaagccg
ctctatgacgacctgcactgctatgtgcgcgcccggctggccaaacagtatggcgaggac
aaggtgcccgcgggcaagcccattcccgcgcacctgcttggcaacatgtgggcccaggaa
tggaacaacatctccaatctggtggagccctatcagggccagcccagcctggacgtgagc
gcggagatccaatcacagaagtatgacgcggtccgcatggtcaagctgggcgaggggttc
ttcacctcgttgggtctcaaggccctgccggagacgttctggcagcgctcccagttcacc
aagccgcgcgaccgcgaggtggtgtgccatgcgagcgcctgggacatcacctacgacaac
gatctgcgcgtgaagatgtgcatcaagcccaccgaggaggatctggtcaccatccaccac
gagctgggccacgactactactacacctactattacaagcttccggtgctctaccagcag
ggggcgaatgatggctttcacgaggccatcggcgacgccatcaccctgtccatcaccccg
agctatctcaagcaggtgggcctgctcaagaaggtgcccgagggcgacaagggcctcatc
aatctgcagatgaaggacgccatggagaaggtggccttcctgcccttcggtctgctcgtg
gaccagtggcgctgggaagtgctctccgggcgggtgaagccggcggactacaacgcctcc
tggtgggcgctgcgcgagaagtaccagggcgtgcgcgcgccggtggagcgctcggagaag
gacttcgacgcgggcgccaagtaccacgtccccgccaacgtgccctacacgcgctacttc
ctggcgcgcatcctccaattccagttccaccgcgcgctgtgccaggccgctggccacaag
ggcccgctccacgagtgctccatctacggcaacaaggacgccggcaagcggctccaggcc
atgttggagttgggcgcgagcaagccttggccagatgcactcgaggccctcaccggggag
cgtcagatggatgcttcggccatcctggaatatttcactcccttgcgtgcctggttgcag
acgcagaacaagggacagaagtgcgggtggtaa

DBGET integrated database retrieval system