KEGG   Melittangium boletus: MEBOL_007618Help
Entry
MEBOL_007618      CDS       T05066                                 

Definition
(GenBank) hypothetical protein
  KO
K12251  N-carbamoylputrescine amidase [EC:3.5.1.53]
Organism
mbd  Melittangium boletus
Pathway
mbd00330  Arginine and proline metabolism
mbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MEBOL_007618
Enzymes [BR:mbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.53  N-carbamoylputrescine amidase
     MEBOL_007618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ATB34117
UniProt: A0A250ISF0
LinkDB All DBs
Position
9299774..9300781
Genome map
AA seq 335 aa AA seqDB search
MSSLRVAALQLRSENGRVQHNLEHARPFIQRAAEQGAQLLLLPEFYPTGYLQSADVWKAG
ETLDGPTVRFLKQQAAQWGVHLGTSFLEAEGDDFYNAFVLASPAGRIHKVRKRRAPSYEA
YWFRGSGDDPCVIDCELGRFSVGICADNHFGDMAACIEGQRAQLHLMPHCYCVPHENPKT
FPAELIEASRRQMETLPVRYASHFGVPVVLANQCGPWNSPLPPPMGSMVKTDRFLGRSAI
VSATGARLRALGEEEEGVIVDTVELRPADYPGDARKIAQAKGRWGWTSLGEPTFATASLA
FKIGAMEWLARRSYRRSAQRKQSAQRVQSGAATPP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccttcgggtcgccgccctgcagctccgctccgagaacgggcgcgtccagcac
aacctggaacacgcccgtcccttcattcaacgcgccgcggagcagggcgcccaactgctg
ctgctcccggagttctaccccacgggttatctgcagagcgcggacgtctggaaggcggga
gagaccctggacgggcccaccgtccgcttcctgaagcaacaggccgcgcagtggggcgtc
cacctggggacctccttcctggaggcggagggggacgacttctacaacgccttcgtcctc
gcttccccggcggggcggatccacaaggtccgcaagcggcgcgcgccctcctacgaggcg
tactggttccggggaagtggtgacgatccctgtgtgatcgactgcgagctcgggcgattc
agcgtgggcatctgcgcggacaaccacttcggggacatggccgcgtgcatcgagggccag
cgggcgcagctccacctcatgccgcactgctactgcgtgccgcacgagaaccccaagacg
ttccccgcggagctcatcgaggcgtcacgccggcagatggagacgctgccggtgcgctac
gcgagccacttcggcgtcccggtggtgctcgccaaccaatgcggcccctggaacagcccc
ctgcccccgcccatgggctccatggtgaagacggaccgtttcctgggccgctccgccatc
gtgtcggccacgggcgccaggctccgcgcgctcggcgaggaagaagaaggcgtcatcgtc
gacaccgtcgagttgcggcccgccgactacccgggggatgcgcggaagatcgcccaggcc
aaggggcgctggggctggacctcgctcggcgagccgacgttcgccacggcctcgctcgcg
ttcaagatcggcgcgatggagtggctggcccgccggagctaccggcgcagcgcgcagcgc
aagcagagcgcccagcgcgtccagtccggagccgccacgcctccctga

DBGET integrated database retrieval system